KEGG   Homo sapiens (human): 91807Help
Entry
91807             CDS       T01001                                 

Gene name
MYLK3, MLCK, MLCK2, RP11-480G7.1, caMLCK
Definition
myosin light chain kinase 3 (EC:2.7.11.18)
Orthology
K00907  
myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Gastric acid secretion
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
16q11.2
AA seq 819 aa AA seqDB search
MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHL
ERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAA
VDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGV
QSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
PLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLMTGRGSLGPTL
TTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGA
EAGSVVLDDSPAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaacctccaaggagagtctggggcatggggggctgccagggttgggcaagacc
tgcttaacaaccatggacacaaagctgaacatgctgaacgagaaggtggaccagctcctg
cacttccaagaagatgtcacagagaagttgcagagcatgtgccgagacatgggccacctg
gagcggggcctgcacaggctggaggcctcccgggcaccgggcccgggcggggctgatggg
gttccccacattgacacccaggctgggtggcccgaggtcctggagctggtgagggccatg
cagcaggatgcggcccagcacggtgccaggctggaggccctcttcaggatggtggctgcg
gtggacagggccatcgctttggtgggggccacgttccagaaatcaaaggtggcggatttc
ctcatgcaggggcgtgtgccctggaggagaggcagcccaggtgacagccctgaggagaat
aaagagcgagtggaagaagagggaggaaaaccaaagcatgtgctgagcaccagtggggtg
cagtctgatgccagggagcctggggaagagagccagaaggcggacgtgctggaggggaca
gcggagaggctgccccccatcagagcgtcagggctgggagctgaccccgcccaggcagtg
gtctcaccgggccagggagatggtgttcctggcccagcccaggcattccctggccacctg
cccctgcccacaaaggtggaagccaaggctcctgagacacccagcgagaacctcaggact
ggcctggaattggctccagcacccggcagggtcaatgtggtctccccgagcctggaggtt
gcaccaggtgcaggacaaggagcatcgtccagcaggcctgaccctgagcccttagaggaa
ggcacgaggctgactccagggcctggccctcagtgcccagggcctccagggctgccagcc
caggccagggcaacccacagtggtggagaaacacctccaaggatctccatccacatacaa
gagatggatactcctggggagatgctgatgacaggcaggggcagccttggacccaccctc
accacagaggctccagcagctgcccagccaggcaagcagggcccacctgggaccgggcgc
tgcctccaagcccctgggactgagcccggagaacagacccctgaaggagccagagagctc
tccccgctgcaggagagcagcagccccgggggagtgaaggcagaggaggagcaaagggct
ggggccgagcctggcacgagaccaagcttggccaggagtgacgacaatgaccacgaggtt
ggggccctgggcctgcagcagggcaaaagcccaggggcgggaaaccctgagcctgagcag
gactgtgcagccagggctccggtgagagctgaagcagtaaggaggatgcccccaggcgcc
gaggctggcagcgtggttctggatgacagtccggccccaccagctccttttgaacaccgg
gtagtgagcgtcaaggagacctccatctctgcgggttacgaggtgtgccagcacgaagtc
ttgggagggggtcggtttggccaggtccacaggtgcacagagaagtccacaggcctccca
ctggctgccaagatcatcaaagtgaagagcgccaaggaccgggaggacgtgaagaacgag
atcaacatcatgaaccagctcagccacgtgaacctgatccagctctatgacgccttcgag
agcaagcacagctgcacccttgtcatggagtacgtggacgggggtgagctcttcgaccgg
atcacagatgagaagtaccacctgactgagctggatgtggtcctgttcaccaggcagatc
tgtgagggtgtgcattacctgcaccagcactacatcctgcacctggacctcaagccggag
aacatattgtgcgtcaatcagacaggacatcaaattaagatcattgactttgggctggcc
agaaggtacaagcctcgagagaagctgaaggtgaacttcggcactcctgagttcctggcc
ccagaagtcgtcaattatgagtttgtctcattccccacagacatgtggagtgtgggagtc
atcacctacatgctactcagtggcttgtccccatttctaggggaaacagatgcagagacc
atgaatttcattgtaaactgtagctgggattttgatgctgacacctttgaagggctctcg
gaggaggccaaggactttgtttcccggttgctggtcaaagagaagagctgcagaatgagt
gccacacagtgcctgaaacacgagtggctgaataatttgcctgccaaagcttcaagatcc
aaaactcgtctcaaatcccaactactgctgcagaaatacatagctcaaagaaaatggaag
aaacatttctatgtggtgactgctgccaacaggttaaggaaatttccaacttctccctaa

DBGET integrated database retrieval system