KEGG   Homo sapiens (human): 91807Help
Entry
91807             CDS       T01001                                 

Gene name
MYLK3, MLCK, MLCK2, caMLCK
Definition
myosin light chain kinase 3 (EC:2.7.11.18)
Orthology
K00907  
myosin-light-chain kinase [EC:2.7.11.18]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Focal adhesion
Platelet activation
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    91807 (MYLK3)
   04022 cGMP - PKG signaling pathway
    91807 (MYLK3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    91807 (MYLK3)
  Cellular commiunity
   04510 Focal adhesion
    91807 (MYLK3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    91807 (MYLK3)
  Endocrine system
   04921 Oxytocin signaling pathway
    91807 (MYLK3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    91807 (MYLK3)
  Digestive system
   04971 Gastric acid secretion
    91807 (MYLK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     91807 (MYLK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MLCK family
   91807 (MYLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
16q11.2
AA seq 819 aa AA seqDB search
MSGTSKESLGHGGLPGLGKTCLTTMDTKLNMLNEKVDQLLHFQEDVTEKLQSMCRDMGHL
ERGLHRLEASRAPGPGGADGVPHIDTQAGWPEVLELVRAMQQDAAQHGARLEALFRMVAA
VDRAIALVGATFQKSKVADFLMQGRVPWRRGSPGDSPEENKERVEEEGGKPKHVLSTSGV
QSDAREPGEESQKADVLEGTAERLPPIRASGLGADPAQAVVSPGQGDGVPGPAQAFPGHL
PLPTKVEAKAPETPSENLRTGLELAPAPGRVNVVSPSLEVAPGAGQGASSSRPDPEPLEE
GTRLTPGPGPQCPGPPGLPAQARATHSGGETPPRISIHIQEMDTPGEMLMTGRGSLGPTL
TTEAPAAAQPGKQGPPGTGRCLQAPGTEPGEQTPEGARELSPLQESSSPGGVKAEEEQRA
GAEPGTRPSLARSDDNDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVRRMPPGA
EAGSVVLDDSPAPPAPFEHRVVSVKETSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP
LAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDR
ITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLA
RRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAET
MNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRS
KTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRKFPTSP
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaacctccaaggagagtctggggcatggggggctgccagggttgggcaagacc
tgcttaacaaccatggacacaaagctgaacatgctgaacgagaaggtggaccagctcctg
cacttccaagaagatgtcacagagaagttgcagagcatgtgccgagacatgggccacctg
gagcggggcctgcacaggctggaggcctcccgggcaccgggcccgggcggggctgatggg
gttccccacattgacacccaggctgggtggcccgaggtcctggagctggtgagggccatg
cagcaggatgcggcccagcacggtgccaggctggaggccctcttcaggatggtggctgcg
gtggacagggccatcgctttggtgggggccacgttccagaaatcaaaggtggcggatttc
ctcatgcaggggcgtgtgccctggaggagaggcagcccaggtgacagccctgaggagaat
aaagagcgagtggaagaagagggaggaaaaccaaagcatgtgctgagcaccagtggggtg
cagtctgatgccagggagcctggggaagagagccagaaggcggacgtgctggaggggaca
gcggagaggctgccccccatcagagcgtcagggctgggagctgaccccgcccaggcagtg
gtctcaccgggccagggagatggtgttcctggcccagcccaggcattccctggccacctg
cccctgcccacaaaggtggaagccaaggctcctgagacacccagcgagaacctcaggact
ggcctggaattggctccagcacccggcagggtcaatgtggtctccccgagcctggaggtt
gcaccaggtgcaggacaaggagcatcgtccagcaggcctgaccctgagcccttagaggaa
ggcacgaggctgactccagggcctggccctcagtgcccagggcctccagggctgccagcc
caggccagggcaacccacagtggtggagaaacacctccaaggatctccatccacatacaa
gagatggatactcctggggagatgctgatgacaggcaggggcagccttggacccaccctc
accacagaggctccagcagctgcccagccaggcaagcagggcccacctgggaccgggcgc
tgcctccaagcccctgggactgagcccggagaacagacccctgaaggagccagagagctc
tccccgctgcaggagagcagcagccccgggggagtgaaggcagaggaggagcaaagggct
ggggccgagcctggcacgagaccaagcttggccaggagtgacgacaatgaccacgaggtt
ggggccctgggcctgcagcagggcaaaagcccaggggcgggaaaccctgagcctgagcag
gactgtgcagccagggctccggtgagagctgaagcagtaaggaggatgcccccaggcgcc
gaggctggcagcgtggttctggatgacagtccggccccaccagctccttttgaacaccgg
gtagtgagcgtcaaggagacctccatctctgcgggttacgaggtgtgccagcacgaagtc
ttgggagggggtcggtttggccaggtccacaggtgcacagagaagtccacaggcctccca
ctggctgccaagatcatcaaagtgaagagcgccaaggaccgggaggacgtgaagaacgag
atcaacatcatgaaccagctcagccacgtgaacctgatccagctctatgacgccttcgag
agcaagcacagctgcacccttgtcatggagtacgtggacgggggtgagctcttcgaccgg
atcacagatgagaagtaccacctgactgagctggatgtggtcctgttcaccaggcagatc
tgtgagggtgtgcattacctgcaccagcactacatcctgcacctggacctcaagccggag
aacatattgtgcgtcaatcagacaggacatcaaattaagatcattgactttgggctggcc
agaaggtacaagcctcgagagaagctgaaggtgaacttcggcactcctgagttcctggcc
ccagaagtcgtcaattatgagtttgtctcattccccacagacatgtggagtgtgggagtc
atcacctacatgctactcagtggcttgtccccatttctaggggaaacagatgcagagacc
atgaatttcattgtaaactgtagctgggattttgatgctgacacctttgaagggctctcg
gaggaggccaaggactttgtttcccggttgctggtcaaagagaagagctgcagaatgagt
gccacacagtgcctgaaacacgagtggctgaataatttgcctgccaaagcttcaagatcc
aaaactcgtctcaaatcccaactactgctgcagaaatacatagctcaaagaaaatggaag
aaacatttctatgtggtgactgctgccaacaggttaaggaaatttccaacttctccctaa

DBGET integrated database retrieval system