KEGG   Homo sapiens (human): 9181Help
Entry
9181              CDS       T01001                                 

Gene name
ARHGEF2, GEF, GEF-H1, GEFH1, LFP40, P40
Definition
Rho/Rac guanine nucleotide exchange factor (GEF) 2
Orthology
K12791  
Rho guanine nucleotide exchange factor 2
Organism
hsa  Homo sapiens (human)
Pathway
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    9181 (ARHGEF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21-q22
AA seq 986 aa AA seqDB search
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERP
SSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVI
YELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLER
RRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLYKELYARDK
RFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALG
LVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLL
WKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL
ISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQK
DRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIR
EVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSD
SSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRA
NSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLR
ESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPP
QPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHS
PRDFTRMQDIPEETESRDGEAVASES
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggatcgaatccctcacgcgggcgcggatcgaccggagcagagagctggcgagc
aagacccgggaaaaggagaagatgaaggaagccaaggatgcccgctataccaatgggcac
ctcttcaccaccatttcagtttcaggcatgaccatgtgctatgcctgtaacaagagcatc
acagccaaggaagccctcatctgcccaacctgcaatgtgactatccacaaccgctgtaaa
gacaccctcgccaactgtaccaaggtcaagcagaagcaacagaaagcggccctgctgaag
aacaacaccgccttgcagtccgtttctcttcgaagtaagacaaccatccgggagcggcca
agctcggccatctacccctccgacagcttccggcagtccctcctgggctcccgccgtggc
cgctcctccttgtctttagccaagagtgtttctaccaccaacattgctggacatttcaat
gatgagtctcccctggggctgcgccggatcctctcacagtccacagactccctcaacatg
cggaaccgaaccctatccgtggaatccctcattgacgaagcagaggtaatctacagtgag
ctgatgagtgactttgagatggatgagaaggactttgcagctgactcttggagtcttgct
gtggacagcagcttcctgcagcagcataaaaaggaggtgatgaagcagcaagatgtcatc
tatgagctaatccagacagagctgcaccatgtgaggacactgaagatcatgacccgcctc
ttccgcacggggatgctggaagagctacacttggagccaggagtggtccagggcctgttc
ccctgcgtggacgagctcagtgacatccatacacgcttcctcagccagctattagaacgc
cgacgccaggccctgtgccctggcagcacccggaactttgtcatccatcgcttgggtgat
ctgctcatcagccagttctcaggtcctagtgcggagcagatgtgtaagacctactcggag
ttctgcagccgccacagcaaggccttaaagctctataaggagctgtacgcccgagacaaa
cgcttccagcaattcatccggaaagtgacccgccccgccgtgctcaagcggcacggggta
caggagtgcatcctgctggtgactcagcgcatcaccaagtacccgttactcatcagccgc
atcctgcagcattcccacgggatcgaggaggagcgccaggacctgaccacagcactgggg
ctagtgaaggagctgctgtccaatgtggacgagggtatttatcagctggagaaaggggcc
cgtctgcaggagatctacaaccgcatggaccctcgggcccaaaccccagtgcctggcaag
ggcccctttggccgagaggaacttctgaggcgcaaactcatccacgatggctgcctgctc
tggaagacagcgacggggcgcttcaaagatgtgctagtgctgctgatgacagatgtactg
gtgtttctccaggaaaaggaccagaagtacatctttcctaccctggacaagccttcagtg
gtatcgctgcagaatctaatcgtacgagacattgccaaccaggagaaagggatgtttctg
atcagcgcagccccacctgagatgtacgaggtgcacacagcatcccgggatgaccggagc
acctggatccgggtcattcagcagagcgtgcgcacatgcccatccagggaggacttcccc
ctgattgagacagaggatgaggcttacctgcggcgaattaagatggagttgcagcagaag
gaccgggcactggtggagctgctgcgagagaaggtcgggctgtttgctgagatgacccat
ttccaggccgaagaggatggtggcagtgggatggccctgcccaccctgcccaggggcctt
ttccgctctgagtcccttgagtcccctcgtggcgagcggctgctgcaggatgccatccgt
gaggtggagggtctgaaagacctgctggtggggccaggagtggaactgctcttgacaccc
cgagagccagccctgcccttggaaccagacagcggtggtaacacgagtcctggggtcact
gccaatggtgaggccagaaccttcaatggctccattgaactctgcagagctgactcagac
tctagccagagggatcgaaatggaaatcagctgagatcaccgcaagaggaggcgttacag
cgattggtcaatctctatggacttctacatggcctacaggcagctgtggcccagcaggac
actctgatggaagcccggttccctgagggccctgagcggcgggagaagctgtgccgagcc
aactctcgggatggggaggctggcagggctggggctgcccctgtggcccctgaaaagcag
gccacggaactggcattactgcagcggcaacatgcgctgctgcaggaggagctacggcgc
tgccggcggctaggtgaagaacgggcaaccgaagctggcagcctggaggcccggctccgg
gagagtgagcaggcccgggcactgctggagcgtgaggccgaagaggctcgaaggcagctg
gccgccctgggccagaccgagccactcccagctgaggccccctgggcccgcagacctgtg
gatcctcggcggcgcagcctccccgcaggcgatgccctgtacttgagtttcaacccccca
cagcccagccgaggcactgaccgcctggatctacctgtcactactcgctctgtccatcga
aactttgaggaccgagagaggcaggaactggggagccccgaagagcggctgcaagacagc
agtgaccctgacactggcagcgaggaggaaggtagcagccgtctgtctccgccccacagt
ccacgagactttaccagaatgcaggacatcccggaggagacggagagccgcgacggggag
gctgtagcctccgagagctaa

DBGET integrated database retrieval system