KEGG   Homo sapiens (human): 9184Help
Entry
9184              CDS       T01001                                 

Gene name
BUB3, BUB3L, hBUB3
Definition
BUB3 mitotic checkpoint protein
Orthology
K02180  
cell cycle arrest protein BUB3
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    9184 (BUB3)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    9184 (BUB3)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    9184 (BUB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q26
AA seq 326 aa AA seqDB search
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKST
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttctaacgagttcaagctgaaccagccacccgaggatggcatctcctccgtg
aagttcagccccaacacctcccagttcctgcttgtctcctcctgggacacgtccgtgcgt
ctctacgatgtgccggccaactccatgcggctcaagtaccagcacaccggcgccgtcctg
gactgcgccttctacgatccaacgcatgcctggagtggaggactagatcatcaattgaaa
atgcatgatttgaacactgatcaagaaaatcttgttgggacccatgatgcccctatcaga
tgtgttgaatactgtccagaagtgaatgtgatggtcactggaagttgggatcagacagtt
aaactgtgggatcccagaactccttgtaatgctgggaccttctctcagcctgaaaaggta
tataccctctcagtgtctggagaccggctgattgtgggaacagcaggccgcagagtgttg
gtgtgggacttacggaacatgggttacgtgcagcagcgcagggagtccagcctgaaatac
cagactcgctgcatacgagcgtttccaaacaagcagggttatgtattaagctctattgaa
ggccgagtggcagttgagtatttggacccaagccctgaggtacagaagaagaagtatgcc
ttcaaatgtcacagactaaaagaaaataatattgagcagatttacccagtcaatgccatt
tcttttcacaatatccacaatacatttgccacaggtggttctgatggctttgtaaatatt
tgggatccatttaacaaaaagcgactgtgccaattccatcggtaccccacgagcatcgca
tcacttgccttcagtaatgatgggactacgcttgcaatagcgtcatcatatatgtatgaa
atggatgacacagaacatcctgaagatggtatcttcattcgccaagtgacagatgcagaa
acaaaacccaagtccacctaa

DBGET integrated database retrieval system