KEGG   Homo sapiens (human): 91851Help
Entry
91851             CDS       T01001                                 

Gene name
CHRDL1, CHL, MGC1, MGCN, NRLN1, VOPT, dA141H5.1
Definition
(RefSeq) chordin-like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq23
AA seq 456 aa AA seqDB search
MRKKWKMGGMKYIFSLLFFLLLEGGKTEQVKHSETYCMFQDKKYRVGERWHPYLEPYGLV
YCVNCICSENGNVLCSRVRCPNVHCLSPVHIPHLCCPRCPDSLPPVNNKVTSKSCEYNGT
TYQHGELFVAEGLFQNRQPNQCTQCSCSEGNVYCGLKTCPKLTCAFPVSVPDSCCRVCRG
DGELSWEHSDGDIFRQPANREARHSYHRSHYDPPPSRQAGGLSRFPGARSHRGALMDSQQ
ASGTIVQIVINNKHKHGQVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNVTKQECKKI
HCPNRYPCKYPQKIDGKCCKVCPGKKAKELPGQSFDNKGYFCGEETMPVYESVFMEDGET
TRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFT
EGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaagtggaaaatgggaggcatgaaatacatcttttcgttgttgttctttctt
ttgctagaaggaggcaaaacagagcaagtaaaacattcagagacatattgcatgtttcaa
gacaagaagtacagagtgggtgagagatggcatccttacctggaaccttatgggttggtt
tactgcgtgaactgcatctgctcagagaatgggaatgtgctttgcagccgagtcagatgt
ccaaatgttcattgcctttctcctgtgcatattcctcatctgtgctgccctcgctgccca
gactccttacccccagtgaacaataaggtgaccagcaagtcttgcgagtacaatgggaca
acttaccaacatggagagctgttcgtagctgaagggctctttcagaatcggcaacccaat
caatgcacccagtgcagctgttcggagggaaacgtgtattgtggtctcaagacttgcccc
aaattaacctgtgccttcccagtctctgttccagattcctgctgccgggtatgcagagga
gatggagaactgtcatgggaacattctgatggtgatatcttccggcaacctgccaacaga
gaagcaagacattcttaccaccgctctcactatgatcctccaccaagccgacaggctgga
ggtctgtcccgctttcctggggccagaagtcaccggggagctcttatggattcccagcaa
gcatcaggaaccattgtgcaaattgtcatcaataacaaacacaagcatggacaagtgtgt
gtttccaatggaaagacctattctcatggcgagtcctggcacccaaacctccgggcattt
ggcattgtggagtgtgtgctatgtacttgtaatgtcaccaagcaagagtgtaagaaaatc
cactgccccaatcgatacccctgcaagtatcctcaaaaaatagacggaaaatgctgcaag
gtgtgtccaggtaaaaaagcaaaagaacttccaggccaaagctttgacaataaaggctac
ttctgcggggaagaaacgatgcctgtgtatgagtctgtattcatggaggatggggagaca
accagaaaaatagcactggagactgagagaccacctcaggtagaggtccacgtttggact
attcgaaagggcattctccagcacttccatattgagaagatctccaagaggatgtttgag
gagcttcctcacttcaagctggtgaccagaacaaccctgagccagtggaagatcttcacc
gaaggagaagctcagatcagccagatgtgttcaagtcgtgtatgcagaacagagcttgaa
gatttagtcaaggttttgtacctggagagatctgaaaagggccactgttag

DBGET integrated database retrieval system