KEGG   Homo sapiens (human): 9187Help
Entry
9187              CDS       T01001                                 

Gene name
SLC24A1, CSNB1D, HsT17412, NCKX, NCKX1, RODX
Definition
solute carrier family 24 (sodium/potassium/calcium exchanger), member 1
Orthology
K13749  
solute carrier family 24 (sodium/potassium/calcium exchanger), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Phototransduction
Disease
H00787  
Congenital stationary night blindness (CSNB)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    9187 (SLC24A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22
AA seq 426 aa AA seqDB search
MPGIITVGCFPVRLAKEKEEESLNQGARAQPQAKAESKPEEEEPAKLPAVTVTPAPVPDI
KGDQKENPGGQEDVAEAESTGEMPGEEGETAGEGETEEKSGGETQPEGEGETETQGKGEE
CEDENEAEGKGDNEGEDEGEIHAEDGEMKGNEGETESQELSAENHGEAKNDEKGVEDGGG
SDGGDSEEEEEEEEEQEEEEEEEEQEEEEEEEEEEEEKGNEEPLSLDWPETRQKQAIYLF
LLPIVFPLWLTVPDVRRQESRKFFVFTFLGSIMWIAMFSYLMVWWAHQVGETIGISEEIM
GLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPVPWLLFSLINGLQP
VPVSSNGLFCAIVLLFLMLLFVISSIASCKWRMNKILGFTMFLLYFVFLIISVMLEDRII
SCPVSV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcatcatcactgtggggtgcttcccagttcgccttgccaaggagaaggaggag
gagagcttgaatcaaggggccagagcccaaccccaggccaaagcagaaagcaaaccagaa
gaggaggagccagccaagctccctgcggtcacggtcacaccagcccctgttccagacatc
aagggagatcagaaggagaatccaggcggtcaggaagatgtggctgaggccgagagcaca
ggtgaaatgccaggcgaagagggcgaaactgctggtgaaggtgaaactgaagagaaaagt
ggaggtgaaactcaaccagaaggtgaaggtgaaactgaaacacaaggaaaaggagaagaa
tgtgaagatgaaaatgaagcagaaggaaaaggagacaatgaaggtgaagatgagggtgaa
atccacgcagaagatggtgaaatgaaaggtaatgaaggtgaaactgaaagccaggaactc
agtgctgaaaatcacggtgaagccaaaaatgatgagaaaggtgtagaagatggaggggga
agtgatggaggggatagcgaagaggaggaagaggaggaggaagagcaggaggaagaggag
gaggaggaagagcaggaggaagaggaggaggaggaggaggaagaggaggagaagggaaat
gaagagcctctgtccctggactggcctgaaaccaggcagaagcaggccatttacctcttc
cttctgcccatcgtgttcccactgtggctgacagtccccgacgtccgaaggcaggagtct
aggaagttttttgttttcaccttcctgggatctatcatgtggatagccatgttctcatac
ctcatggtgtggtgggctcaccaggttggtgaaacaatagggatttctgaagagatcatg
ggcctgacaatccttgcagcaggcacatcaattcctgacctcatcaccagtgtgattgtc
gctcgaaaaggcctgggagacatggctgtgtcaagctctgtgggcagtaacatatttgat
atcactgtgggcttgcctgttccttggttgcttttctctcttatcaatggattacagcca
gttccagtcagcagcaatggcttgttttgtgcaattgttttgctttttctcatgcttctg
tttgtgatctcttcaattgcgtcatgtaaatggagaatgaacaagatcctgggcttcaca
atgttcctcctttactttgtattcctgataatcagtgtgatgttagaagatcgaatcata
tcctgtcctgtatctgtctga

DBGET integrated database retrieval system