KEGG   Homo sapiens (human): 9187Help
Entry
9187              CDS       T01001                                 

Gene name
SLC24A1, CSNB1D, HsT17412, NCKX, NCKX1, RODX
Definition
(RefSeq) solute carrier family 24 member 1
  KO
K13749  
solute carrier family 24 (sodium/potassium/calcium exchanger), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Phototransduction
Disease
H00787  
Congenital stationary night blindness (CSNB)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04744 Phototransduction
    9187 (SLC24A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   9187 (SLC24A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q22
AA seq 1099 aa AA seqDB search
MGKLIRMGPQERWLLRTKRLHWSRLLFLLGMLIIGSTYQHLRRPRGLSSLWAAVSSHQPI
KLASRDLSSEEMMMMSSSPSKPSSEMGGKMLVPQASVGSDEATLSMTVENIPSMPKRTAK
MIPTTTKNNYSPTAAGTERRKEDTPTSSRTLTYYTSTSSRQIVKKYTPTPRGEMKSYSPT
QVREKVKYTPSPRGRRVGTYVPSTFMTMETSHAITPRTTVKDSDITATYKILETNSLKRI
MEETTPTTLKGMFDSTPTFLTHEVEANVLTSPRSVMEKNNLFPPRRVESNSSAHPWGLVG
KSNPKTPQGTVLLHTPATSEGQVTISTMTGSSPAETKAFTAAWSLRNPSPRTSVSAIKTA
PAIVWRLAKKPSTAPSTSTTPTVRAKLTMQVHHCVVVKPTPAMLTTPSPSLTTALLPEEL
SPSPSVLPPSLPDLHPKGEYPPDLFSVEERRQGWVVLHVFGMMYVFVALAIVCDEYFVPA
LGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVI
GTCSLFSREILNLTWWPLFRDVSFYILDLIMLILFFLDSLIAWWESLLLLLAYAFYVFTM
KWNKHIEVWVKEQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSST
SLHNSTIRSTIYQLMLHSLDPLREVRLAKEKEEESLNQGARAQPQAKAESKPEEEEPAKL
PAVTVTPAPVPDIKGDQKENPGGQEDVAEAESTGEMPGEEGETAGEGETEEKSGGETQPE
GEGETETQGKGEECEDENEAEGKGDNEGEDEGEIHAEDGEMKGNEGETESQELSAENHGE
AKNDEKGVEDGGGSDGGDSEEEEEEEEEQEEEEEEEEQEEEEEEEEEEEEKGNEEPLSLD
WPETRQKQAIYLFLLPIVFPLWLTVPDVRRQESRKFFVFTFLGSIMWIAMFSYLMVWWAH
QVGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPV
PWLLFSLINGLQPVPVSSNGLFCAIVLLFLMLLFVISSIASCKWRMNKILGFTMFLLYFV
FLIISVMLEDRIISCPVSV
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atggggaaattgatcaggatggggccgcaagagaggtggttactccggacaaagcggctt
cattggagtcgcctcctcttcttactgggaatgttgatcatcggttctacttatcagcac
cttaggagaccccggggcctttcctcattgtgggcagcagtctcttctcatcagcctata
aaactggccagtcgggacctctccagtgaagagatgatgatgatgagcagcagcccttca
aaacctagctccgaaatggggggtaagatgctggtaccccaagcctcagtgggcagtgat
gaagcaacactgagcatgacagtggagaatatccccagtatgcctaaaagaacagccaag
atgatcccaacaacaaccaagaataattacagcccaacagcagcaggtacagaaagaagg
aaggaagacaccccaacatccagtagaacactgacttactacacctcaacttcaagcaga
caaatagtaaaaaagtataccccaacacccaggggagaaatgaagagctacagcccaact
caagtgagggaaaaggtgaagtatactccttccccacgtggtagaagagtaggcacttac
gtgccgtccacattcatgacaatggaaacaagccatgcgatcacccccaggacaacagtg
aaagacagtgacattacagcaacctataaaatactcgaaaccaactctcttaagagaata
atggaggaaaccaccccaaccactctcaagggaatgtttgatagcaccccaacttttctg
acacatgaggtagaagcaaacgtcttgacttctccaaggagcgtcatggaaaaaaacaac
ctgtttccccccagaagagtggaaagtaacagctcagcccatccctgggggttagtggga
aagagcaacccgaagactccccagggaacagtcctgttgcataccccagccacctctgag
gggcaggtgacaataagcaccatgacaggcagcagcccagcagaaaccaaagccttcact
gctgcctggagtcttaggaatccttcacccaggaccagtgtatcagccatcaaaacagcc
ccagccatagtctggaggctggcaaagaaaccttccacagcacccagcacctcaacaacc
cctacggtcagggcaaagctgaccatgcaggtccatcactgtgtggttgtgaagccaacc
ccagccatgctcaccactccctccccaagcctcacaacagccctgctcccagaggagctc
agtcctagtccctcagtgctgcctcccagcttgccagacctccaccccaagggagagtac
cccccagatctgttcagtgtggaggagcggcggcagggctgggtggtcctgcacgttttt
ggcatgatgtatgtgtttgtggccttggccattgtttgcgacgagtacttcgttccagcc
ctgggtgtcatcacagacaagctgcagatctccgaggatgtggcaggcgccacattcatg
gctgctggaggctctgctcctgagctcttcacctccctcatcggtgtcttcatttcccac
agcaacgtgggcattggtaccattgtgggctctgctgtgttcaacattctctttgtcatt
ggcacttgttccctcttctcccgagagatcctcaacctcacctggtggcccttattccgt
gatgtctccttctacatccttgacctgataatgctcatcctcttcttcctggacagcctc
attgcctggtgggagagcctgctgctgctgctggcctatgccttctatgtgttcaccatg
aagtggaacaagcatatcgaggtctgggtgaaggagcagctcagcaggaggccagtggcc
aaggtcatggccttagaagacctcagcaagccgggcgatggggccattgcggtggatgag
ctacaggataacaagaagctgaagctcccgtccttgctgacccgagggagcagctcgacc
tctctgcacaacagcaccatccgcagcaccatctaccagctcatgctccacagcctggac
cccctgagggaagttcgccttgccaaggagaaggaggaggagagcttgaatcaaggggcc
agagcccaaccccaggccaaagcagaaagcaaaccagaagaggaggagccagccaagctc
cctgcggtcacggtcacaccagcccctgttccagacatcaagggagatcagaaggagaat
ccaggcggtcaggaagatgtggctgaggccgagagcacaggtgaaatgccaggcgaagag
ggcgaaactgctggtgaaggtgaaactgaagagaaaagtggaggtgaaactcaaccagaa
ggtgaaggtgaaactgaaacacaaggaaaaggagaagaatgtgaagatgaaaatgaagca
gaaggaaaaggagacaatgaaggtgaagatgagggtgaaatccacgcagaagatggtgaa
atgaaaggtaatgaaggtgaaactgaaagccaggaactcagtgctgaaaatcacggtgaa
gccaaaaatgatgagaaaggtgtagaagatggagggggaagtgatggaggggatagcgaa
gaggaggaagaggaggaggaagagcaggaggaagaggaggaggaggaagagcaggaggaa
gaggaggaggaggaggaggaagaggaggagaagggaaatgaagagcctctgtccctggac
tggcctgaaaccaggcagaagcaggccatttacctcttccttctgcccatcgtgttccca
ctgtggctgacagtccccgacgtccgaaggcaggagtctaggaagttttttgttttcacc
ttcctgggatctatcatgtggatagccatgttctcatacctcatggtgtggtgggctcac
caggttggtgaaacaatagggatttctgaagagatcatgggcctgacaatccttgcagca
ggcacatcaattcctgacctcatcaccagtgtgattgtcgctcgaaaaggcctgggagac
atggctgtgtcaagctctgtgggcagtaacatatttgatatcactgtgggcttgcctgtt
ccttggttgcttttctctcttatcaatggattacagccagttccagtcagcagcaatggc
ttgttttgtgcaattgttttgctttttctcatgcttctgtttgtgatctcttcaattgcg
tcatgtaaatggagaatgaacaagatcctgggcttcacaatgttcctcctttactttgta
ttcctgataatcagtgtgatgttagaagatcgaatcatatcctgtcctgtatctgtctga

DBGET integrated database retrieval system