KEGG   Homo sapiens (human): 92Help
Entry
92                CDS       T01001                                 

Gene name
ACVR2A, ACTRII, ACVR2
Definition
activin A receptor, type IIA (EC:2.7.11.30)
Orthology
K04670  
activin receptor type-2A [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    92 (ACVR2A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    92 (ACVR2A)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    92 (ACVR2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     92 (ACVR2A)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   92 (ACVR2A)
Enzyme-linked receptors [BR:hsa01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   92 (ACVR2A)
Cytokine receptors [BR:hsa04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   92 (ACVR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q22.3
AA seq 513 aa AA seqDB search
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgtttgccgtctttcttatctcctgttcttcaggtgct
atacttggtagatcagaaactcaggagtgtcttttctttaatgctaattgggaaaaagac
agaaccaatcaaactggtgttgaaccgtgttatggtgacaaagataaacggcggcattgt
tttgctacctggaagaatatttctggttccattgaaatagtgaaacaaggttgttggctg
gatgatatcaactgctatgacaggactgattgtgtagaaaaaaaagacagccctgaagta
tatttttgttgctgtgagggcaatatgtgtaatgaaaagttttcttattttccggagatg
gaagtcacacagcccacttcaaatccagttacacctaagccaccctattacaacatcctg
ctctattccttggtgccacttatgttaattgcggggattgtcatttgtgcattttgggtg
tacaggcatcacaagatggcctaccctcctgtacttgttccaactcaagacccaggacca
cccccaccttctccattactaggtttgaaaccactgcagttattagaagtgaaagcaagg
ggaagatttggttgtgtctggaaagcccagttgcttaacgaatatgtggctgtcaaaata
tttccaatacaggacaaacagtcatggcaaaatgaatacgaagtctacagtttgcctgga
atgaagcatgagaacatattacagttcattggtgcagaaaaacgaggcaccagtgttgat
gtggatctttggctgatcacagcatttcatgaaaagggttcactatcagactttcttaag
gctaatgtggtctcttggaatgaactgtgtcatattgcagaaaccatggctagaggattg
gcatatttacatgaggatatacctggcctaaaagatggccacaaacctgccatatctcac
agggacatcaaaagtaaaaatgtgctgttgaaaaacaacctgacagcttgcattgctgac
tttgggttggccttaaaatttgaggctggcaagtctgcaggcgatacccatggacaggtt
ggtacccggaggtacatggctccagaggtattagagggtgctataaacttccaaagggat
gcatttttgaggatagatatgtatgccatgggattagtcctatgggaactggcttctcgc
tgtactgctgcagatggacctgtagatgaatacatgttgccatttgaggaggaaattggc
cagcatccatctcttgaagacatgcaggaagttgttgtgcataaaaaaaagaggcctgtt
ttaagagattattggcagaaacatgctggaatggcaatgctctgtgaaaccattgaagaa
tgttgggatcacgacgcagaagccaggttatcagctggatgtgtaggtgaaagaattacc
cagatgcagagactaacaaatattattaccacagaggacattgtaacagtggtcacaatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

DBGET integrated database retrieval system