KEGG   Homo sapiens (human): 92Help
Entry
92                CDS       T01001                                 

Gene name
ACVR2A, ACTRII, ACVR2
Definition
(RefSeq) activin A receptor type 2A
  KO
K04670  activin receptor type-2A [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00679  BMP signaling
hsa_M00681  Activin signaling
Drug target
Bimagrumab: D10620
Sotatercept: D09670
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    92 (ACVR2A)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    92 (ACVR2A)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    92 (ACVR2A)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    92 (ACVR2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     92 (ACVR2A)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   92 (ACVR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp FTA2 APH
Motif
Other DBs
NCBI-GeneID: 92
NCBI-ProteinID: NP_001265508
OMIM: 102581
HGNC: 173
Ensembl: ENSG00000121989
Vega: OTTHUMG00000150603
Pharos: P27037(Tbio)
UniProt: P27037
Structure
PDB: 

Jmol
Position
2q22.3-q23.1
AA seq 513 aa AA seqDB search
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgtttgccgtctttcttatctcctgttcttcaggtgct
atacttggtagatcagaaactcaggagtgtcttttctttaatgctaattgggaaaaagac
agaaccaatcaaactggtgttgaaccgtgttatggtgacaaagataaacggcggcattgt
tttgctacctggaagaatatttctggttccattgaaatagtgaaacaaggttgttggctg
gatgatatcaactgctatgacaggactgattgtgtagaaaaaaaagacagccctgaagta
tatttttgttgctgtgagggcaatatgtgtaatgaaaagttttcttattttccggagatg
gaagtcacacagcccacttcaaatccagttacacctaagccaccctattacaacatcctg
ctctattccttggtgccacttatgttaattgcggggattgtcatttgtgcattttgggtg
tacaggcatcacaagatggcctaccctcctgtacttgttccaactcaagacccaggacca
cccccaccttctccattactaggtttgaaaccactgcagttattagaagtgaaagcaagg
ggaagatttggttgtgtctggaaagcccagttgcttaacgaatatgtggctgtcaaaata
tttccaatacaggacaaacagtcatggcaaaatgaatacgaagtctacagtttgcctgga
atgaagcatgagaacatattacagttcattggtgcagaaaaacgaggcaccagtgttgat
gtggatctttggctgatcacagcatttcatgaaaagggttcactatcagactttcttaag
gctaatgtggtctcttggaatgaactgtgtcatattgcagaaaccatggctagaggattg
gcatatttacatgaggatatacctggcctaaaagatggccacaaacctgccatatctcac
agggacatcaaaagtaaaaatgtgctgttgaaaaacaacctgacagcttgcattgctgac
tttgggttggccttaaaatttgaggctggcaagtctgcaggcgatacccatggacaggtt
ggtacccggaggtacatggctccagaggtattagagggtgctataaacttccaaagggat
gcatttttgaggatagatatgtatgccatgggattagtcctatgggaactggcttctcgc
tgtactgctgcagatggacctgtagatgaatacatgttgccatttgaggaggaaattggc
cagcatccatctcttgaagacatgcaggaagttgttgtgcataaaaaaaagaggcctgtt
ttaagagattattggcagaaacatgctggaatggcaatgctctgtgaaaccattgaagaa
tgttgggatcacgacgcagaagccaggttatcagctggatgtgtaggtgaaagaattacc
cagatgcagagactaacaaatattattaccacagaggacattgtaacagtggtcacaatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

DBGET integrated database retrieval system