KEGG   Homo sapiens (human): 9201Help
Entry
9201              CDS       T01001                                 

Gene name
DCLK1, CL1, CLICK1, DCAMKL1, DCDC3A, DCLK
Definition
(RefSeq) doublecortin like kinase 1
  KO
K08805  doublecortin-like kinase 1/2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9201 (DCLK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  DCAMKL family
   9201 (DCLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase DCX Pkinase_Tyr Kdo Kinase-like RIO1
Motif
Other DBs
NCBI-GeneID: 9201
NCBI-ProteinID: NP_001317000
OMIM: 604742
HGNC: 2700
Ensembl: ENSG00000133083
Vega: OTTHUMG00000016729
Pharos: O15075(Tchem)
UniProt: O15075
Structure
PDB: 

Jmol
Position
13q13.3
AA seq 740 aa AA seqDB search
MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVR
FYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSL
DQLVEGESYVCGSIEPFKKLEYTKNVNPNWSVNVKTTSASRAVSSLATAKGSPSEVRENK
DFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSGVVKRLYTLDGK
QVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPG
PSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHGGSSTSLASTK
VCSSMDENDGPGEEVSEEGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKI
IKKSKCRGKEHMIQNEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITST
NKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIV
DGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQ
ILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLS
VAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNS
ESEDYSPSSSETVRSPNSPF
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcggcagagacatggagctggagcacttcgacgagcgggataaggcgcagaga
tacagccgagggtcgcgggtgaacggcctgccgagcccgacgcacagcgcccactgcagc
ttctaccgcacccgcacgctgcagacgctcagctccgagaagaaggccaagaaagttcgt
ttctatcgaaacggagatcgatacttcaaagggattgtgtatgccatctccccagaccgg
ttccgatcttttgaggccctgctggctgatttgacccgaactctgtcggataacgtgaat
ttgccccagggagtgagaacaatctacaccattgatgggctcaagaagatttccagcctg
gaccaactggtggaaggagagagttatgtatgtggctccatagagcccttcaagaaactg
gagtacaccaagaatgtgaaccccaactggtcggtgaacgtcaagaccacctcggcttct
cgggcagtgtcttcactggccactgccaaaggaagcccttcagaggtgcgagagaataag
gatttcattcggcccaagctggtcaccatcatcagaagtggcgtgaagccacggaaagct
gtcaggattctgctgaacaagaaaacggctcattcctttgagcaggtcctcaccgatatc
accgatgccatcaagctggactcgggagtggtgaaacgcctgtacacgttggatgggaaa
caggtgatgtgccttcaggacttttttggtgatgatgacatttttattgcatgtggaccg
gagaagttccgttaccaggatgatttcttgctagatgaaagtgaatgtcgagtggtaaag
tccacttcttacaccaaaatagcttcatcatcccgcaggagcaccaccaagagcccagga
ccgtccaggcgtagcaagtcccctgcctccaccagctcagttaatggaacccctggtagt
cagctctctactccgcgctcaggcaagtcgccaagcccatcacccaccagcccaggaagc
ctgcggaagcagaggagctctcagcatggcggctcctctacgtcacttgcgtccaccaaa
gtctgcagctcgatggatgagaacgatggccctggagaagaagtgtcggaggaaggcttc
cagattccagctacaataacagaacgatataaagtcggaagaacaataggagatggaaat
tttgctgttgtcaaggaatgtgtagaaagatcgactgctagagagtatgctctgaaaatt
atcaagaaaagcaaatgtcgaggcaaagagcacatgatccagaatgaagtgtctatttta
agaagagtgaagcatcccaatatcgttcttctgattgaggagatggatgtgccaactgaa
ctgtatcttgtcatggaattagtaaaggggggagacctttttgatgccattacttccact
aacaaatacaccgagagagacgccagtgggatgctgtacaacctagccagcgccatcaaa
tacctgcatagcctgaacatcgtccaccgtgatatcaagccagagaacctgctggtgtat
gagcaccaagatggcagcaaatcactgaagctgggtgactttggactggccaccattgta
gacggccccctgtacacagtctgtggcaccccaacatacgtggctccagaaatcattgca
gagactggatacggcctcaaggtggacatctgggcagcaggtgtaatcacttatatcctg
ctgtgtggtttccctccattccgtggaagtggtgatgaccaggaggtgctttttgatcag
attttgatggggcaggtggactttccttctccatactgggataatgtttccgattctgca
aaggagctcattaccatgatgctgttggtcgatgtagatcagcgattttctgctgttcaa
gtacttgagcatccctgggttaatgatgatggcctcccagaaaatgaacatcagctgtca
gtagctggaaagataaagaagcatttcaacacaggccccaagccgaatagcacagcagct
ggagtttctgtcatagcaaccaccgctcttgataaggagaggcaggttttccgacgaaga
cgcaaccaggatgtgaggagccggtacaaggcgcagccagctcctcccgaactcaactcg
gaatcggaagactactccccaagctcctccgagactgttcgctcccctaactcgcccttt
taa

DBGET integrated database retrieval system