KEGG   Homo sapiens (human): 9208Help
Entry
9208              CDS       T01001                                 

Gene name
LRRFIP1, FLAP-1, FLAP1, FLIIAP1, GCF-2, GCF2, HUFI-1, TRIP
Definition
(RefSeq) LRR binding FLII interacting protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.3
AA seq 808 aa AA seqDB search
MTSPAAAQSREIDCLSPEAQKLAEARLAAKRAARAEAREIRMKELERQQKEEDSERYSRR
SRRNTSASDEDERMSVGSRGSLRVEERPEKDFTEKGSRNMPGLSAATLASLGGTSSRRGS
GDTSISIDTEASIREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQ
LDNEKTNFMYQVDTLKDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQFQFAEVKEA
LKQREEMLEKHGIILNSEIATNGETSDTLNNVGYQGPTKMTKEELNALKSTGDGTLGRAS
EVEVKNEIVANVGKREILHNTEKEQHTEDTVKDCVDIEVFPAGENTEDQKSSEDTAPFLG
TLAGATYEEQVQSQILESSSLPENTVQVESNEVMGAPDDRTRTPLEPSNCWSDLDGGNHT
ENVGEAAVTQVEEQAGTVASCPLGHSDDTVYHDDKCMVEVPQELETSTGHSLEKEFTNQE
AAEPKEVPAHSTEVGRDHNEEEGEETGLRDEKPIKTEVPGSPAGTEGNCQEATGPSTVDT
QNEPLDMKEPDEEKSDQQGEALDSSQKKTKNKKKKNKKKKSPVPVETLKDVKKELTYQNT
DLSEIKEEEQVKSTDRKSAVEAQNEVTENPKQKIAAESSENVDCPENPKIKLDGKLDQEG
DDVQTAAEEVLADGDTLDFEDDTVQSSGPRAGGEELDEGVAKDNAKIDGATQSSPAEPKS
EDADRCTLPEHESPSQDISDACEAESTERCEMSEHPSQTVRKALDSNSLENDDLSAPGRE
PGHFNPESREDTRGGNEKGKSKEDCTMS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccccgcggccgctcaaagccgggagatcgactgtttgagcccggaagcgcag
aagctggcggaagcccggctcgctgcaaaacgggcggcccgcgcggaggctcgcgagatc
cgcatgaaggagctggagcggcagcagaaggaggaagacagtgagcgctactctcgtaga
tccagaagaaacacatcggcttctgatgaagacgagcgcatgtcagtgggtagtcgtgga
agcctgagggtagaagagagaccagaaaaagattttactgagaaggggtctcgtaacatg
ccgggcctgtctgcagccacgctggcctctctgggtgggacttcctctcggagaggcagc
ggagacacctccatctccatcgacaccgaggcatccatcagggaaatcaaggaactcaat
gagttaaaggaccagattcaggatgtagaaggcaaatacatgcagggattgaaagagatg
aaggactctctagcagaagttgaagagaaatataagaaggctatggtttccaatgctcag
ctagacaatgaaaagacaaacttcatgtaccaggttgataccctaaaagatatgttgctg
gagcttgaagaacagctggctgaatctaggcggcagtacgaagagaaaaacaaagaattt
gaaagggaaaaacacgcccacagtatactgcaatttcagtttgctgaagtcaaggaggcc
ctgaagcaaagagaggaaatgctcgagaaacatggaataatcctaaattcagaaatagct
accaatggagagacttccgacaccctcaataatgttggataccaaggtcctaccaagatg
acaaaagaagagttaaatgccctcaagtcgacaggggatgggaccctaggaagagccagt
gaagtggaggtgaaaaatgaaatcgtggcgaatgtggggaaaagagaaatcttgcacaat
actgagaaagaacaacacacagaggacacagtgaaggactgtgtggacatagaggtattc
cctgctggtgagaataccgaggaccagaaatcctctgaagacactgccccattcctagga
accttagcaggtgctacctatgaggaacaggttcaaagccaaattcttgagagcagttct
ctccctgaaaacacagtacaggttgagtcaaatgaggtcatgggtgcaccagatgacagg
accagaactccccttgagccatccaactgttggagtgacttagatggtgggaaccacaca
gagaatgtgggagaggcagcagtgactcaggttgaagagcaggcaggcacagtggcctcg
tgtcctttagggcatagtgatgacacagtttatcatgatgacaaatgtatggtagaggtc
ccccaagagttagagacaagcacagggcatagtttagagaaagaattcaccaaccaggaa
gcagctgagcccaaggaggttccagcgcacagtacagaagtaggtagggatcacaacgaa
gaagagggtgaagaaacaggattaagggacgagaaaccaatcaagacagaagttcctggt
tctccagcaggaactgagggcaactgtcaggaagcgacaggtccaagtacagtagacact
caaaatgaacccttagatatgaaagagcccgatgaagaaaagagtgaccaacagggagag
gcattggactcatcgcagaagaagacaaagaacaagaaaaagaaaaacaagaagaaaaaa
tccccagtacccgtagaaacccttaaagatgttaaaaaagagttaacgtatcagaacaca
gatttaagtgaaattaaggaagaagagcaggtaaagtctactgacagaaagtcagcagtg
gaagcccaaaacgaggtgactgaaaatccaaaacagaaaattgcagcagaaagcagtgaa
aatgttgattgtccggagaatcctaaaattaagttggatggaaaacttgaccaagaaggt
gatgatgtacaaacagcagctgaggaggtactagctgatggagacacattagattttgag
gatgacaccgttcaatcatcaggcccgagggctggtggtgaagaattagatgaaggtgtt
gcaaaagataatgctaaaatagatggtgccactcaaagcagtcctgcagaaccaaagagc
gaagacgcagatcgctgcaccctgcccgaacatgaaagtccctcacaggacattagtgat
gcctgtgaagcagaaagtacagagaggtgtgagatgtcagaacatccaagtcagaccgtc
aggaaagctttagacagcaatagcctagagaacgatgacttgtcggcaccaggaagagag
ccagggcacttcaatccagaaagcagagaagataccagaggagggaatgagaagggcaaa
agcaaagaagactgtaccatgtcctaa

DBGET integrated database retrieval system