KEGG   Homo sapiens (human): 9218Help
Entry
9218              CDS       T01001                                 

Gene name
VAPA, VAP-33, VAP-A, VAP33, hVAP-33
Definition
(RefSeq) VAMP associated protein A
  KO
K06096  
vesicle-associated membrane protein-associated protein A
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    9218 (VAPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.22
AA seq 249 aa AA seqDB search
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYC
VRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDE
LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECK
RLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFI
GFFLGKFIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcctcaggggccatggcgaagcacgagcagatcctggtcctcgatccgccc
acagacctcaaattcaaaggccccttcacagatgtagtcactacaaatcttaaattgcga
aatccatcggatagaaaagtgtgtttcaaagtgaagactacagcacctcgccggtactgt
gtgaggcccaacagtggaattattgacccagggtcaactgtgactgtttcagtaatgcta
cagccctttgactatgatccgaatgaaaagagtaaacacaagtttatggtacagacaatt
tttgctccaccaaacacttcagatatggaagctgtgtggaaagaggcaaaacctgatgaa
ttaatggattccaaattgagatgcgtatttgaaatgcccaatgaaaatgataaattgaat
gatatggaacctagcaaagctgttccactgaatgcatctaagcaagatggacctatgcca
aaaccacacagtgtttcacttaatgataccgaaacaaggaaactaatggaagagtgtaaa
agacttcagggagaaatgatgaagctatcagaagaaaatcggcacctgagagatgaaggt
ttaaggctcagaaaggtagcacattcggataaacctggatcaacctcaactgcatccttc
agagataatgtcaccagtcctcttccttcacttcttgttgtaattgcagccattttcatt
ggattctttctagggaaattcatcttgtag

DBGET integrated database retrieval system