KEGG   Homo sapiens (human): 9218Help
Entry
9218              CDS       T01001                                 

Gene name
VAPA, VAP-33, VAP-A, VAP33, hVAP-33
Definition
(RefSeq) VAMP associated protein A
  KO
K06096  
vesicle-associated membrane protein-associated protein A
Organism
hsa  Homo sapiens (human)
Brite
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    9218 (VAPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9P0L0(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.22
AA seq 249 aa AA seqDB search
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYC
VRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDE
LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECK
RLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFI
GFFLGKFIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcctcaggggccatggcgaagcacgagcagatcctggtcctcgatccgccc
acagacctcaaattcaaaggccccttcacagatgtagtcactacaaatcttaaattgcga
aatccatcggatagaaaagtgtgtttcaaagtgaagactacagcacctcgccggtactgt
gtgaggcccaacagtggaattattgacccagggtcaactgtgactgtttcagtaatgcta
cagccctttgactatgatccgaatgaaaagagtaaacacaagtttatggtacagacaatt
tttgctccaccaaacacttcagatatggaagctgtgtggaaagaggcaaaacctgatgaa
ttaatggattccaaattgagatgcgtatttgaaatgcccaatgaaaatgataaattgaat
gatatggaacctagcaaagctgttccactgaatgcatctaagcaagatggacctatgcca
aaaccacacagtgtttcacttaatgataccgaaacaaggaaactaatggaagagtgtaaa
agacttcagggagaaatgatgaagctatcagaagaaaatcggcacctgagagatgaaggt
ttaaggctcagaaaggtagcacattcggataaacctggatcaacctcaactgcatccttc
agagataatgtcaccagtcctcttccttcacttcttgttgtaattgcagccattttcatt
ggattctttctagggaaattcatcttgtag

DBGET integrated database retrieval system