KEGG   Homo sapiens (human): 9223Help
Entry
9223              CDS       T01001                                 

Gene name
MAGI1, AIP-3, AIP3, BAIAP1, BAP-1, BAP1, MAGI-1, Magi1d, TNRC19, WWP3
Definition
membrane associated guanylate kinase, WW and PDZ domain containing 1
Orthology
K05631  
atrophin-1 interacting protein 3 (BAI1-associated protein 1)
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    9223 (MAGI1)
 Cellular Processes
  Cell communication
   04530 Tight junction
    9223 (MAGI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p14.1
AA seq 1462 aa AA seqDB search
MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGE
GPRLGEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRF
QKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVG
TYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEE
EDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQYLPLSAEDNLG
PLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELE
LPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQ
QTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSR
GFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQ
SIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTG
KVNGMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADS
PGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQ
RGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQ
TDSSGQKKPDPFKIWAQSRSMYENRLPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIG
HIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVVFA
VPKTENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIGSGGGGGSG
VVSTVVQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFGNACVAMPHKIGRIIEGSPADR
CGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIA
TITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDFYTVELERGAKGFGFSLRGG
REYNMDLYVLRLAEDGPAERCGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLF
LKRGDGSVPEYDPSSDRHGPATGPQGVPEVRAGPDRRQHPSLESSYPPDLHKSSPHGEKR
AHARDPKGSREYSRQPNEHHTWNGTSRKPDSGACRPKDRAPEGRRDAQAERAAAANGPKR
RSPEKRREGTRSADNTLERREKHEKRRDVSPERRRERSPTRRRDGSPSRRRRSLERLLEQ
RRSPERRRGGSPERRAKSTDRRRARSPERRRERSLDKRNREDRASHREREEANLKQDAGR
SSRHPPEQRRRPYKECSTDLSI
NT seq 4389 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagtgatccagaagaagaaccactggactagcagggttcacgaatgcaccgtg
aagcggggaccccagggcgagctgggggtgacggtgctgggaggcgcggagcacggggag
tttccgtacgtcggagcggtggcggcggtcgaggcagcggggcttcccggcggcggcgag
ggcccgaggctgggcgaaggggagctgcttctggaggtgcagggggtccgggtgtccggc
ttgccccgctatgacgtgctgggggtcatcgacagctgcaaggaggccgtcaccttcaag
gccgtcagacaaggaggaaggctgaacaaggacctgcgacattttctcaatcagcgattc
cagaaggggtctcctgatcatgagctccagcagaccataagggataacctttaccgccat
gctgtgccttgcacaacccgatctcccagagaaggagaagtgcctggcgtggactataac
tttctgactgtgaaggagttcttggacctcgagcagagtgggactcttctggaagtcggc
acctatgaaggaaactattatgggacacccaagcctcctagccagccagtcagtgggaaa
gtgatcacgacggatgccttgcacagccttcagtctggctctaagcagtcgaccccgaag
cgaaccaagtcctacaatgatatgcaaaatgctggcatagtccacgcggagaatgaggag
gaggatgacgttcctgaaatgaacagcagctttacagccgattctggtgaacaagaggag
cacactctccaagaaacagcattaccacctgtgaatagtagcatcatcgctgctcccatc
acggacccttctcagaagttccctcaatacctacctctttctgcagaggataatttaggt
cctctacctgaaaactgggagatggcctatactgaaaatggagaagtctattttatagac
cataacacgaaaacaacatcttggttagaccctcggtgcctaaacaagcagcagaagcca
ctggaagagtgtgaagatgatgaaggggtacacaccgaggagctggacagtgaactagaa
ctgcctgctggttgggaaaagattgaagaccctgtctatggtatctactatgtagaccac
atcaacaggaagacacaatatgagaacccggttctagaagccaaacggaagaagcagctt
gagcagcagcagcagcagcaacagcagcagcaacagcagcagcagcagcagcagcagcag
cagacagaagaatggacagaagatcactcagcccttgtgcctcctgttattccaaaccac
cctccaagcaatccagagccagccagagaagttccacttcagggcaaacccttttttaca
cgaaacccttctgagttgaaaggcaagttcattcacacaaagctgcggaaaagcagtcgt
ggctttggcttcacggtggttggaggggatgaacctgatgagtttctccagatcaagagc
ttggtcctagatggtcctgctgcattggatggcaagatggaaacaggggatgtgattgta
agtgtgaatgacacctgtgttttgggacacacacatgctcaagttgtgaagatcttccag
tccatccccattggtgccagcgtggaccttgaactctgccgaggttatccattgcctttt
gatccagatgaccccaatacaagtttagtgacctcggtagccattttggataaagaacca
attattgtgaatgggcaagagacctatgattcaccagctagccacagtagtaaaacaggc
aaagtcaatggcatgaaggatgccaggccaagcagcccagcggacgtggcttcaaatagt
tctcatggttatcctaatgacactgtttctttggcttcctccatagccactcagccagaa
ctcataactgttcatattgtcaaagggccaatgggctttggttttactatcgcagacagt
cctggtgggggtggccaaagagtgaaacagattgttgacagcccaaggtgccgaggcctg
aaagaaggggatctcatagtggaagttaataagaagaacgtgcaggccctaactcacaac
caagtggtggatatgctggttgagtgtcctaagggaagtgaggtcacattgttggtgcaa
cgaggagggctgccagttcccaagaagagcccaaagtcgcaaccactggaaaggaaagac
agccagaatagttctcagcacagtgtttccagccaccgaagcctgcacacagcatcccca
agccacagcacacaggtgctccccgagttcccacctgcagaggcccaagctccagatcaa
actgacagctctggccagaaaaaaccagatccttttaaaatctgggcccagtccaggagc
atgtatgaaaaccgacttccagattaccaggaacaggacatcttcctctggagaaaagag
actggatttggatttaggattctgggtggaaatgaaccaggggaacctatttatattggt
cacatcgtaccactgggtgctgctgatactgacggccgcctgaggtctggagatgaatta
atctgtgtggatgggacgccagtaattggaaaatcacaccagcttgtggtccagcttatg
caacaagctgccaagcaaggccacgtcaatctcacggtgcggcgtaaagtggtttttgcg
gtgcccaaaaccgagaacgaggtgccctcgccagcctcctctcatcacagtagcaaccag
ccggcctcgctgacagaagagaagcgcactccgcagggcagccagaactcgctgaacacg
gtgagctcgggcagcggcagcaccagcggcatcggcagtggcggcggcgggggcagcggc
gtggtcagcaccgtggtgcagccctacgacgtggagatccggcgcggggagaacgagggc
ttcggcttcgtcatcgtgtcctcggtgagcaggcccgaagcaggcacgacctttggcaat
gcatgtgtggctatgcctcacaaaataggtcggattattgaggggagccctgctgaccgc
tgtggcaagctgaaagtaggagaccggatcttggcagtaaatggatgttccatcaccaac
aaatcccattcagacattgtgaacctaatcaaggaagcgggaaacacagttaccctccgc
atcattcctggggatgagtcctcgaatgccaccttgctgaccaatgcagagaagattgcc
accatcaccaccacacacaccccttctcagcaagggacccaggagacaaggaataccacc
aaaccaaagcaggaatctcaatttgagttcaaagcaccccaagcaacacaggagcaagat
ttttacactgtggaactggaaagaggagccaagggatttggctttagccttcgaggaggc
cgagagtataacatggacctctatgttctgcgcttagcagaggacggtcctgcggagagg
tgtggaaagatgaggattggtgatgaaattttagagatcaatggtgagaccaccaaaaac
atgaagcattctcgagctatagaactgattaagaatggtggccgcagagttcgtctgttt
ctgaagcggggagacggctcagtaccagaatatgaccccagcagcgaccgccacggcccc
gccaccggtccacaaggtgttccggaagtgagggccgggcccgaccgccggcagcatccg
tcattggagtccagttacccacccgatcttcacaaatcatcaccacatggggaaaagcgg
gcacacgcaagggatccgaaaggcagcagagagtatagcagacaacccaatgaacaccac
acctggaatgggacttcgaggaaacccgacagcggggcatgccgacccaaggaccgggcg
ccggagggacggagggacgcgcaggccgagcgcgcggcagccgccaacggccccaagagg
cggtccccagagaagcggagggagggcacccgcagcgccgacaacactttggagaggagg
gagaagcacgagaagagacgagacgtctctccggagcggaggcgagagcggtcacccacc
cgcaggagagacggctcccccagccggcggagacggtctctggagagactcctggagcag
aggaggtcccccgagcgcaggagagggggctcgcccgagcgcagggccaagtccaccgac
cggaggcgcgcacgctcccccgagcgcaggagagagcggtccctggacaaaaggaacaga
gaggacagagccagccaccgagaaagggaagaggcgaatctgaaacaggatgccggcaga
agttccagacatcccccggagcagagaaggcgaccttacaaagaatgtagcaccgacctc
agtatctga

DBGET integrated database retrieval system