KEGG   Homo sapiens (human): 9227Help
Entry
9227              CDS       T01001                                 

Gene name
LRAT, LCA14
Definition
lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase) (EC:2.3.1.135)
Orthology
K00678  
phosphatidylcholine-retinol O-acyltransferase [EC:2.3.1.135]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Vitamin digestion and absorption
Disease
H00527  
Retinitis pigmentosa (RP)
H00837  
Leber congenital amaurosis (LCR)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    9227 (LRAT)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    9227 (LRAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.135  phosphatidylcholine---retinol O-acyltransferase
     9227 (LRAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q32.1
AA seq 230 aa AA seqDB search
MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDVLEVPRTHLTH
YGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGA
NILVNHLDESLQKKALLNEEVARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQSDK
FCETVKIIIRDQRSVLASAVLGLASIVCTGLVSYTTLPAIFIPFFLWMAG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccccatgctggaggtggtgtctttactactggagaagctgctcctcatctcc
aacttcacgctctttagttcgggcgccgcgggcgaagacaaagggaggaacagtttttat
gaaaccagctctttccaccgaggcgacgtgctggaggtgccccggacccacctgacccac
tatggcatctacctaggagacaaccgtgttgcccacatgatgcccgacatcctgttggcc
ctgacagacgacatggggcgcacgcagaaggtggtctccaacaagcgtctcatcctgggc
gttattgtcaaagtggccagcatccgcgtggacacagtggaggacttcgcctacggagct
aacatcctggtcaatcacctggacgagtccctccagaaaaaggcactgctcaacgaggag
gtggcgcggagggctgaaaagctgctgggctttaccccctacagcctgctgtggaacaac
tgcgagcacttcgtgacctactgcagatatggcaccccgatcagtccccagtccgacaag
ttttgtgagactgtgaagataattattcgtgatcagagaagtgttcttgcttcagcagtc
ttgggattggcgtctatagtctgtacgggcttggtatcatacactacccttcctgcaatt
tttattccattcttcctatggatggctggctaa

DBGET integrated database retrieval system