KEGG   Homo sapiens (human): 9227Help
Entry
9227              CDS       T01001                                 

Gene name
LRAT, LCA14
Definition
lecithin retinol acyltransferase (phosphatidylcholine--retinol O-acyltransferase) (EC:2.3.1.135)
Orthology
K00678  
phosphatidylcholine-retinol O-acyltransferase [EC:2.3.1.135]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Vitamin digestion and absorption
Disease
H00527  
Retinitis pigmentosa (RP)
H00837  
Leber congenital amaurosis (LCR)
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q32.1
AA seq 230 aa AA seqDB search
MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDVLEVPRTHLTH
YGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAYGA
NILVNHLDESLQKKALLNEEVARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQSDK
FCETVKIIIRDQRSVLASAVLGLASIVCTGLVSYTTLPAIFIPFFLWMAG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccccatgctggaggtggtgtctttactactggagaagctgctcctcatctcc
aacttcacgctctttagttcgggcgccgcgggcgaagacaaagggaggaacagtttttat
gaaaccagctctttccaccgaggcgacgtgctggaggtgccccggacccacctgacccac
tatggcatctacctaggagacaaccgtgttgcccacatgatgcccgacatcctgttggcc
ctgacagacgacatggggcgcacgcagaaggtggtctccaacaagcgtctcatcctgggc
gttattgtcaaagtggccagcatccgcgtggacacagtggaggacttcgcctacggagct
aacatcctggtcaatcacctggacgagtccctccagaaaaaggcactgctcaacgaggag
gtggcgcggagggctgaaaagctgctgggctttaccccctacagcctgctgtggaacaac
tgcgagcacttcgtgacctactgcagatatggcaccccgatcagtccccagtccgacaag
ttttgtgagactgtgaagataattattcgtgatcagagaagtgttcttgcttcagcagtc
ttgggattggcgtctatagtctgtacgggcttggtatcatacactacccttcctgcaatt
tttattccattcttcctatggatggctggctaa

DBGET integrated database retrieval system