KEGG   Homo sapiens (human): 923Help
Entry
923               CDS       T01001                                 

Gene name
CD6, TP120
Definition
(RefSeq) CD6 molecule
  KO
K06456  
T-cell surface glycoprotein CD6
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    923 (CD6)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   Others
    ALCAM; activated leukocyte cell adhesion molecule [KO:K06547]
     923 (CD6)
Cellular antigens [BR:hsa04090]
 Proteins
  923 (CD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P30203(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.2
AA seq 668 aa AA seqDB search
MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEV
RLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANAT
LAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHG
EWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK
VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLC
SASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDS
GSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTA
NPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP
NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDND
DYDDISAA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttcttcgggatcactggattgctgacggcagccctctcaggtcatccatct
ccagccccacctgaccagctcaacaccagcagtgcagagagtgagctctgggagccaggg
gagcggcttccggtccgtctgacaaacgggagcagcagctgcagcgggacggtggaggtg
cggctcgaggcgtcctgggagcccgcgtgcggggcgctctgggacagccgcgccgccgag
gccgtgtgccgagcactgggctgcggcggggcggaggccgcctctcagctcgccccgccg
acccctgagctgccgcccccgcctgcagccgggaacaccagcgtagcagctaatgccact
ctggccggggcgcccgccctcctgtgcagcggcgccgagtggcggctctgcgaggtggtg
gagcacgcgtgccgcagcgacgggaggcgggcccgtgtcacctgtgcagagaaccgcgcg
ctgcgcctggtggacggtggcggcgcctgcgccggccgcgtggagatgctggagcatggc
gagtggggatcagtgtgcgatgacacttgggacctggaggacgcccacgtggtgtgcagg
caactgggctgcggctgggcagtccaggccctgcccggcttgcacttcacgcccggccgc
gggcctatccaccgggaccaggtgaactgctcgggggccgaagcttacctgtgggactgc
ccggggctgccaggacagcactactgcggccacaaagaggacgcgggcgcggtgtgctca
gagcaccagtcctggcgcctgacagggggcgctgaccgctgcgaggggcaggtggaggta
cacttccgaggggtctggaacacagtgtgtgacagtgagtggtacccatcggaggccaag
gtgctctgccagtccttgggctgtggaactgcggttgagaggcccaaggggctgccccac
tccttgtccggcaggatgtactactcatgcaatggggaggagctcaccctctccaactgc
tcctggcggttcaacaactccaacctctgcagccagtcgctggcagccagggtcctctgc
tcagcttcccggagtttgcacaatctgtccactcccgaagtccctgcaagtgttcagaca
gtcactatagaatcttctgtgacagtgaaaatagagaacaaggaatctcgggagctaatg
ctcctcatcccctccatcgttctgggaattctcctccttggctccctcatcttcatagcc
ttcatcctcttgagaattaaaggaaaatatgccctccccgtaatggtgaaccaccagcac
ctacccaccaccatcccggcagggagcaatagctatcaaccggtccccatcaccatcccc
aaagaagttttcatgctgcccatccaggtccaggccccgccccctgaggactcagactct
ggctcggactcagactatgagcactatgacttcagcgcccagcctcctgtggccctgacc
accttctacaattcccagcggcatcgggtcacagatgaggaggtccagcaaagcaggttc
cagatgccacccttggaggaaggacttgaagagttgcatgcctcccacatcccaactgcc
aaccctggacactgcattacagacccgccatccctgggccctcagtatcacccgaggagc
aacagtgagtcgagcacctcttcaggggaggattactgcaatagtcccaaaagcaagctg
cctccatggaacccccaggtgttttcttcagagaggagttccttcctggagcagccccca
aacttggagctggccggcacccagccagccttttcagcagggcccccggctgatgacagc
tccagcacctcatccggggagtggtaccagaacttccagccaccaccccagcccccttcg
gaggagcagtttggctgtccagggtcccccagccctcagcctgactccaccgacaacgat
gactacgatgacatcagcgcagcctag

DBGET integrated database retrieval system