KEGG   Homo sapiens (human): 9230Help
Entry
9230              CDS       T01001                                 

Gene name
RAB11B, H-YPT3
Definition
RAB11B, member RAS oncogene family
Orthology
K07905  
Ras-related protein Rab-11B
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
AMPK signaling pathway
Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    9230 (RAB11B)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    9230 (RAB11B)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    9230 (RAB11B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9230 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   9230 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   9230 (RAB11B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    9230 (RAB11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 218 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca
ggcgtgggcaagagcaacctgctgtcgcgcttcacccgcaacgagttcaacctggagagc
aagagcaccatcggcgtggagttcgccacccgcagcatccaggtggacggcaagaccatc
aaggcgcagatctgggacaccgctggccaggagcgctaccgcgccatcacctccgcgtac
taccgtggtgcagtgggcgccctgctggtgtacgacatcgccaagcacctgacctatgag
aacgtggagcgctggctgaaggagctgcgggaccacgcagacagcaacatcgtcatcatg
ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggcccgc
gccttcgcagaaaagaacaacttgtccttcatcgagacctcagccttggattccactaac
gtagaggaagcattcaagaacatcctcacagagatctaccgcatcgtgtcacagaaacag
atcgcagaccgcgctgcccacgacgagtccccggggaacaacgtggtggacatcagcgtg
ccgcccaccacggacggacagaagcccaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system