KEGG   Homo sapiens (human): 9230Help
Entry
9230              CDS       T01001                                 

Gene name
RAB11B, H-YPT3, NDAGSCW
Definition
(RefSeq) RAB11B, member RAS oncogene family
  KO
K07905  Ras-related protein Rab-11B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
hsa04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    9230 (RAB11B)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    9230 (RAB11B)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    9230 (RAB11B)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    9230 (RAB11B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9230 (RAB11B)
  Exosomal proteins of other body fluids (saliva and urine)
   9230 (RAB11B)
  Exosomal proteins of colorectal cancer cells
   9230 (RAB11B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    9230 (RAB11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 AAA_22 RsgA_GTPase GTP_EFTU Gtr1_RagA AAA_16 FeoB_N ABC_tran PduV-EutP SRPRB AAA_14 AAA_24 TniB FAD-SLDH AAA_21 AAA_5
Motif
Other DBs
NCBI-GeneID: 9230
NCBI-ProteinID: NP_004209
OMIM: 604198
HGNC: 9761
Ensembl: ENSG00000185236
Vega: OTTHUMG00000182278
Pharos: Q15907(Tbio)
UniProt: Q15907
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 218 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca
ggcgtgggcaagagcaacctgctgtcgcgcttcacccgcaacgagttcaacctggagagc
aagagcaccatcggcgtggagttcgccacccgcagcatccaggtggacggcaagaccatc
aaggcgcagatctgggacaccgctggccaggagcgctaccgcgccatcacctccgcgtac
taccgtggtgcagtgggcgccctgctggtgtacgacatcgccaagcacctgacctatgag
aacgtggagcgctggctgaaggagctgcgggaccacgcagacagcaacatcgtcatcatg
ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggcccgc
gccttcgcagaaaagaacaacttgtccttcatcgagacctcagccttggattccactaac
gtagaggaagcattcaagaacatcctcacagagatctaccgcatcgtgtcacagaaacag
atcgcagaccgcgctgcccacgacgagtccccggggaacaacgtggtggacatcagcgtg
ccgcccaccacggacggacagaagcccaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system