KEGG   Homo sapiens (human): 9230Help
Entry
9230              CDS       T01001                                 

Gene name
RAB11B, H-YPT3
Definition
RAB11B, member RAS oncogene family
Orthology
K07905  
Ras-related protein Rab-11B
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Vasopressin-regulated water reabsorption
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 218 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ
IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggggacccgggacgacgagtacgactacctattcaaagtggtgctcatcggggactca
ggcgtgggcaagagcaacctgctgtcgcgcttcacccgcaacgagttcaacctggagagc
aagagcaccatcggcgtggagttcgccacccgcagcatccaggtggacggcaagaccatc
aaggcgcagatctgggacaccgctggccaggagcgctaccgcgccatcacctccgcgtac
taccgtggtgcagtgggcgccctgctggtgtacgacatcgccaagcacctgacctatgag
aacgtggagcgctggctgaaggagctgcgggaccacgcagacagcaacatcgtcatcatg
ctggtgggcaacaagagtgacctgcgccacctgcgggctgtgcccactgacgaggcccgc
gccttcgcagaaaagaacaacttgtccttcatcgagacctcagccttggattccactaac
gtagaggaagcattcaagaacatcctcacagagatctaccgcatcgtgtcacagaaacag
atcgcagaccgcgctgcccacgacgagtccccggggaacaacgtggtggacatcagcgtg
ccgcccaccacggacggacagaagcccaacaagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system