KEGG   Homo sapiens (human): 92335Help
Entry
92335             CDS       T01001                                 

Gene name
STRADA, LYK5, NY-BR-96, PMSE, STRAD, Stlk
Definition
(RefSeq) STE20-related kinase adaptor alpha
  KO
K08271  STE20-related kinase adapter protein alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
Disease
H01112  Polyhydramnios, megalencephaly, and symptomatic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    92335 (STRADA)
   04150 mTOR signaling pathway
    92335 (STRADA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   92335 (STRADA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 92335
NCBI-ProteinID: NP_001003787
OMIM: 608626
HGNC: 30172
Ensembl: ENSG00000266173
Vega: OTTHUMG00000178908
Pharos: Q7RTN6(Tbio)
UniProt: Q7RTN6
Structure
PDB: 

Jmol
Position
17q23.3
AA seq 431 aa AA seqDB search
MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMS
SFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELH
VSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVL
KALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKV
LPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLL
DTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCL
QRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTN
LEELEVDDWEF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttcttgtaagtaaaccagagcgaatcaggcggtgggtctcggaaaagttcatt
gttgagggcttaagagatttggaactatttggagagcagcctccgggtgacactcggaga
aaaaccaatgatgcgagctcagagtcaatagcatccttctctaaacaggaggtcatgagt
agctttctgccagagggagggtgttacgagctgctcactgtgataggcaaaggatttgag
gacctgatgactgtgaatctagcaaggtacaaaccaacaggagagtacgtgactgtacgg
aggattaacctagaagcttgttccaatgagatggtaacattcttgcagggcgagctgcat
gtctccaaactcttcaaccatcccaatatcgtgccatatcgagccacttttattgcagac
aatgagctgtgggttgtcacatcattcatggcatacggttctgcaaaagatctcatctgt
acacacttcatggatggcatgaatgagctggcgattgcttacatcctgcagggggtgctg
aaggccctcgactacatccaccacatgggatatgtacacaggagtgtcaaagccagccac
atcctgatctctgtggatgggaaggtctacctgtctggtttgcgcagcaacctcagcatg
ataagccatgggcagcggcagcgagtggtccacgattttcccaagtacagtgtcaaggtt
ctgccgtggctcagccccgaggtcctccagcagaatctccagggttatgatgccaagtct
gacatctacagtgtgggaatcacagcctgtgaactggccaacggccatgtcccctttaag
gatatgcctgccacccagatgctgctagagaaactgaacggcacagtgccctgcctgttg
gataccagcaccatccccgctgaggagctgaccatgagcccttcgcgctcagtggccaac
tctggcctgagtgacagcctgaccaccagcaccccccggccctccaacggtgactcgccc
tcccacccctaccaccgaaccttctccccccacttccaccactttgtggagcagtgcctt
cagcgcaacccggatgccaggcccagtgccagcaccctcctgaaccactctttcttcaag
cagatcaagcgacgtgcctcagaggctttgcccgaattgcttcgtcctgtcacccccatc
accaattttgagggcagccagtctcaggaccacagtggaatctttggcctggtaacaaac
ctggaagagctggaggtggacgattgggagttctga

DBGET integrated database retrieval system