KEGG   Homo sapiens (human): 92359Help
Entry
92359             CDS       T01001                                 

Gene name
CRB3
Definition
crumbs family member 3
Orthology
K06090  
crumbs 3
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    92359 (CRB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 120 aa AA seqDB search
MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAI
IVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccccgggctggggctgcttctggcgctgggcctgccgttcctgctggcccgc
tggggccgagcctgggggcaaatacagaccacttctgcaaatgagaatagcactgttttg
ccttcatccaccagctccagctccgatggcaacctgcgtccagaagccatcactgctatc
atcgtggtcttctccctcttggctgccttgctcctggctgtggggctggcactgttggtg
cggaagcttcgggagaagcggcagacggagggcacctaccggcccagtagcgaggagcag
gtgggtgcccgcgtgccaccgacccccaacctcaagttgccgccggaagagcggctcatc
tga

DBGET integrated database retrieval system