KEGG   Homo sapiens (human): 92359Help
Entry
92359             CDS       T01001                                 

Gene name
CRB3
Definition
crumbs homolog 3 (Drosophila)
Orthology
K06090  
crumbs 3
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Class
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 120 aa AA seqDB search
MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAI
IVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccccgggctggggctgcttctggcgctgggcctgccgttcctgctggcccgc
tggggccgagcctgggggcaaatacagaccacttctgcaaatgagaatagcactgttttg
ccttcatccaccagctccagctccgatggcaacctgcgtccagaagccatcactgctatc
atcgtggtcttctccctcttggctgccttgctcctggctgtggggctggcactgttggtg
cggaagcttcgggagaagcggcagacggagggcacctaccggcccagtagcgaggagcag
gtgggtgcccgcgtgccaccgacccccaacctcaagttgccgccggaagagcggctcatc
tga

DBGET integrated database retrieval system