KEGG   Homo sapiens (human): 9248Help
Entry
9248              CDS       T01001                                 

Gene name
GPR50, H9, Mel1c
Definition
(RefSeq) G protein-coupled receptor 50
  KO
K04287  
G protein-coupled receptor 50
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9248 (GPR50)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Melatonin
    9248 (GPR50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 617 aa AA seqDB search
MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLR
NSGNIFVVSLSVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIV
AIAINRYCYICHSLQYERIFSVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIF
NYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAARDPAGQNPDNQLAEVRNFLTMF
VIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYFIAYFNSCLNAVIYGLLNEN
FRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQDRAHACPAVEE
TPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP
VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGH
HVSAGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELS
ASHCPEIPAIAHPVSDDSDLPESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDY
HDVVVIDVEDDPDEMAV
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggggcccaccctagcggttcccaccccctatggctgtattggctgtaagctaccccag
ccagaatacccaccggctctaatcatctttatgttctgcgcgatggttatcaccatcgtt
gtagacctaatcggcaactccatggtcattttggctgtgacgaagaacaagaagctccgg
aattctggcaacatcttcgtggtcagtctctctgtggccgatatgctggtggccatctac
ccataccctttgatgctgcatgccatgtccattgggggctgggatctgagccagttacag
tgccagatggtcgggttcatcacagggctgagtgtggtcggctccatcttcaacatcgtg
gcaatcgctatcaaccgttactgctacatctgccacagcctccagtacgaacggatcttc
agtgtgcgcaatacctgcatctacctggtcatcacctggatcatgaccgtcctggctgtc
ctgcccaacatgtacattggcaccatcgagtacgatcctcgcacctacacctgcatcttc
aactatctgaacaaccctgtcttcactgttaccatcgtctgcatccacttcgtcctccct
ctcctcatcgtgggtttctgctacgtgaggatctggaccaaagtgctggcggcccgtgac
cctgcagggcagaatcctgacaaccaacttgctgaggttcgcaattttctaaccatgttt
gtgatcttcctcctctttgcagtgtgctggtgccctatcaacgtgctcactgtcttggtg
gctgtcagtccgaaggagatggcaggcaagatccccaactggctttatcttgcagcctac
ttcatagcctacttcaacagctgcctcaacgctgtgatctacgggctcctcaatgagaat
ttccgaagagaatactggaccatcttccatgctatgcggcaccctatcatattcttctct
ggcctcatcagtgatattcgtgagatgcaggaggcccgtaccctggcccgcgcccgtgcc
catgctcgcgaccaagctcgtgaacaagaccgtgcccatgcctgtcctgctgtggaggaa
accccgatgaatgtccggaatgttccattacctggtgatgctgcagctggccaccccgac
cgtgcctctggccaccctaagccccattccagatcctcctctgcctatcgcaaatctgcc
tctacccaccacaagtctgtctttagccactccaaggctgcctctggtcacctcaagcct
gtctctggccactccaagcctgcctctggtcaccccaagtctgccactgtctaccctaag
cctgcctctgtccatttcaaggctgactctgtccatttcaagggtgactctgtccatttc
aagcctgactctgttcatttcaagcctgcttccagcaaccccaagcccatcactggccac
catgtctctgctggcagccactccaagtctgccttcagtgctgccaccagccaccctaaa
cccaccactggccacatcaagccagctaccagccatgctgagcccaccactgctgactat
cccaagcctgccactaccagccaccctaagcccactgctgctgacaaccctgagctctct
gcctcccattgccccgagatccctgccattgcccaccctgtgtctgacgacagtgacctc
cctgagtcggcctctagccctgccgctgggcccaccaagcctgctgccagccagctggag
tctgacaccatcgctgaccttcctgaccctactgtagtcactaccagtaccaatgattac
catgatgtcgtggttattgatgttgaagatgatcctgatgaaatggctgtgtga

DBGET integrated database retrieval system