KEGG   Homo sapiens (human): 9249Help
Entry
9249              CDS       T01001                                 

Gene name
DHRS3, DD83.1, RDH17, Rsdr1, SDR1, SDR16C1, retSDR1
Definition
dehydrogenase/reductase (SDR family) member 3 (EC:1.1.1.300)
Orthology
K11146  
short-chain dehydrogenase/reductase 3 [EC:1.1.1.300]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:hsa00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.1
AA seq 302 aa AA seqDB search
MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE
RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL
VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS
AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP
LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG
RT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggtgtggaaacggctgggcgcgctggtgatgttccctctacagatgatctatctggtg
gtgaaagcagccgtcggactggtgctgcccgccaagctgcgggacctgtcgcgggagaac
gtcctcatcaccggcggcgggagaggcatcgggcgtcagctcgcccgcgagttcgcggag
cgcggcgccagaaagattgttctctggggccggactgagaaatgcctgaaggagacgacg
gaggagatccggcagatgggcactgagtgccattacttcatctgtgatgtgggcaaccgg
gaggaggtgtaccagacggccaaggccgtccgggagaaggtgggtgacatcaccatcctg
gtgaacaatgccgccgtggtccatgggaagagcctaatggacagtgatgatgatgccctc
ctcaagtcccaacacatcaacaccctgggccagttctggaccaccaaggccttcctgcca
cgtatgctggagctgcagaatggccacatcgtgtgcctcaactccgtgctggcactgtct
gccatccccggtgccatcgactactgcacatccaaagcgtcagccttcgccttcatggag
agcctgaccctggggctgctggactgtccgggagtcagcgccaccacagtgctgcccttc
cacaccagcaccgagatgttccagggcatgagagtcaggtttcccaacctctttccccca
ctgaagccggagacggtggcccggaggacagtggaagctgtgcagctcaaccaggccctc
ctcctcctcccatggacaatgcatgccctcgttatcttgaaaagcatacttccacaggct
gcactcgaggagatccacaaattctcaggaacctacacctgcatgaacactttcaaaggg
cggacatag

DBGET integrated database retrieval system