KEGG   Homo sapiens (human): 9252Help
Entry
9252              CDS       T01001                                 

Gene name
RPS6KA5, MSK1, MSPK1, RLPK
Definition
ribosomal protein S6 kinase, 90kDa, polypeptide 5 (EC:2.7.11.1)
Orthology
K04445  
ribosomal protein S6 kinase alpha-5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Circadian entrainment
Neurotrophin signaling pathway
MicroRNAs in cancer
Bladder cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q31-q32.1
AA seq 802 aa AA seqDB search
MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAY
GKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYA
FQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKL
ENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWS
LGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYS
PAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPN
IVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGV
VHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEA
KDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFH
AFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTL
QPSNPADSNNPETLFQFSDSVA
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagggtggcagcagcggcggcgccgcggggaccagcgcggacggcggcgac
ggaggagagcagctcctcactgtcaagcacgagctgcggactgctaatttgacaggacat
gctgagaaggtgggaatagaaaattttgagctcctgaaggtcctaggaactggagcttat
ggaaaagtatttctagttcgtaaaataagtggccatgatactggaaagctgtatgccatg
aaagttttgaaaaaggcaacaatcgttcaaaaggccaaaaccacagagcatacaaggaca
gaacgacaagtcctggaacacattaggcagtcgccatttttggtaacattacattatgct
ttccagacagaaaccaaacttcatctcattttagattatataaatggtggtgaacttttt
actcatctttctcaaagagagcgtttcacagagcatgaggtgcagatttatgttggagag
attgtgcttgccctcgaacatctccacaagttggggattatatatcgtgatattaagctt
gagaatattctacttgattctaatggccatgtggtgctgacagattttggtctgagtaag
gagtttgtggctgatgaaactgaaagagcatattccttttgtggaactattgaatacatg
gcaccagatattgtcagagggggagattcaggacatgacaaggcagttgactggtggagt
ttgggtgttctaatgtatgaattactaactggagcatctcctttcactgttgatggagaa
aaaaattcccaagctgagatatctaggagaatattaaaaagtgagcctccatatccccaa
gaaatgagtgctttagcgaaagacctaattcagcgtcttttgatgaaagatcccaagaag
agattgggatgtggtccacgtgatgcagatgaaatcaaagaacatctcttctttcagaaa
ataaattgggatgatttagccgccaaaaaagtgcctgcaccatttaagccagtcattcga
gatgaattagatgtgagtaactttgcagaagagttcacagaaatggatcccacttattct
cccgcagccctgccccagagttctgagaagctgtttcagggctattcctttgttgctcct
tccatcctattcaagcgtaatgcagctgtcatagaccctcttcagtttcacatgggagtt
gaacgtcctggagtgacaaatgttgccaggagtgcaatgatgaaggactctccattctat
caacactatgacctagatttgaaggacaaacccctgggagaaggtagtttttcaatttgt
cgaaagtgtgtgcataaaaaaagtaaccaagcttttgcagtcaaaataatcagcaaaagg
atggaagccaatactcaaaaggaaataacagctctgaaactctgtgaaggacaccccaat
attgtgaagttgcatgaagtttttcatgatcagcttcacacgtttctagtgatggaactt
ctgaatggaggagaactgtttgagcgcattaagaaaaagaagcacttcagtgagacggaa
gccagctacatcatgaggaagcttgtttcagctgtaagccacatgcatgatgttggagtg
gtgcacagggatctgaaacctgagaatttattgttcaccgatgaaaatgacaatttggaa
attaaaataattgattttggatttgcacggctaaagccaccggataatcagcccctgaag
actccatgcttcacccttcattatgccgccccagagctcttgaatcagaacggctacgat
gagtcctgtgacctgtggagcttgggcgtcattttgtacacaatgttgtcaggacaggtt
cccttccaatctcatgaccgaagtttgacgtgtaccagcgcggtggaaatcatgaagaaa
attaaaaagggagatttctcctttgaaggagaagcctggaagaatgtatcccaagaggct
aaagatttgatccaaggacttctcacagtagatccaaacaaaaggcttaaaatgtctggc
ttgaggtacaatgaatggctacaagatggaagtcagctgtcctccaatcctctgatgact
ccggatattctaggatcttccggagctgccgtgcatacctgtgtgaaagcaaccttccac
gcctttaacaaatacaagagagaggggttttgccttcagaatgttgataaggcccctttg
gctaagagaagaaaaatgaaaaagactagcaccagtaccgagacgcgcagcagttccagt
gagagttcccattcttcttcctctcattctcacggtaaaactacacccaccaagacactg
cagcccagcaatcctgccgacagcaataacccggagaccctcttccagttctcggactca
gtagcttag

DBGET integrated database retrieval system