KEGG   Homo sapiens (human): 9252Help
Entry
9252              CDS       T01001                                 

Gene name
RPS6KA5, MSK1, MSPK1, RLPK
Definition
ribosomal protein S6 kinase, 90kDa, polypeptide 5 (EC:2.7.11.1)
Orthology
K04445  
ribosomal protein S6 kinase alpha-5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Circadian entrainment
Neurotrophin signaling pathway
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    9252 (RPS6KA5)
   04668 TNF signaling pathway
    9252 (RPS6KA5)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    9252 (RPS6KA5)
  Nervous system
   04722 Neurotrophin signaling pathway
    9252 (RPS6KA5)
  Environmental adaptation
   04713 Circadian entrainment
    9252 (RPS6KA5)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    9252 (RPS6KA5)
   05219 Bladder cancer
    9252 (RPS6KA5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9252 (RPS6KA5)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   9252 (RPS6KA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q31-q32.1
AA seq 802 aa AA seqDB search
MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAY
GKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYA
FQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKL
ENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWS
LGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYS
PAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPN
IVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGV
VHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEA
KDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFH
AFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTL
QPSNPADSNNPETLFQFSDSVA
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagggtggcagcagcggcggcgccgcggggaccagcgcggacggcggcgac
ggaggagagcagctcctcactgtcaagcacgagctgcggactgctaatttgacaggacat
gctgagaaggtgggaatagaaaattttgagctcctgaaggtcctaggaactggagcttat
ggaaaagtatttctagttcgtaaaataagtggccatgatactggaaagctgtatgccatg
aaagttttgaaaaaggcaacaatcgttcaaaaggccaaaaccacagagcatacaaggaca
gaacgacaagtcctggaacacattaggcagtcgccatttttggtaacattacattatgct
ttccagacagaaaccaaacttcatctcattttagattatataaatggtggtgaacttttt
actcatctttctcaaagagagcgtttcacagagcatgaggtgcagatttatgttggagag
attgtgcttgccctcgaacatctccacaagttggggattatatatcgtgatattaagctt
gagaatattctacttgattctaatggccatgtggtgctgacagattttggtctgagtaag
gagtttgtggctgatgaaactgaaagagcatattccttttgtggaactattgaatacatg
gcaccagatattgtcagagggggagattcaggacatgacaaggcagttgactggtggagt
ttgggtgttctaatgtatgaattactaactggagcatctcctttcactgttgatggagaa
aaaaattcccaagctgagatatctaggagaatattaaaaagtgagcctccatatccccaa
gaaatgagtgctttagcgaaagacctaattcagcgtcttttgatgaaagatcccaagaag
agattgggatgtggtccacgtgatgcagatgaaatcaaagaacatctcttctttcagaaa
ataaattgggatgatttagccgccaaaaaagtgcctgcaccatttaagccagtcattcga
gatgaattagatgtgagtaactttgcagaagagttcacagaaatggatcccacttattct
cccgcagccctgccccagagttctgagaagctgtttcagggctattcctttgttgctcct
tccatcctattcaagcgtaatgcagctgtcatagaccctcttcagtttcacatgggagtt
gaacgtcctggagtgacaaatgttgccaggagtgcaatgatgaaggactctccattctat
caacactatgacctagatttgaaggacaaacccctgggagaaggtagtttttcaatttgt
cgaaagtgtgtgcataaaaaaagtaaccaagcttttgcagtcaaaataatcagcaaaagg
atggaagccaatactcaaaaggaaataacagctctgaaactctgtgaaggacaccccaat
attgtgaagttgcatgaagtttttcatgatcagcttcacacgtttctagtgatggaactt
ctgaatggaggagaactgtttgagcgcattaagaaaaagaagcacttcagtgagacggaa
gccagctacatcatgaggaagcttgtttcagctgtaagccacatgcatgatgttggagtg
gtgcacagggatctgaaacctgagaatttattgttcaccgatgaaaatgacaatttggaa
attaaaataattgattttggatttgcacggctaaagccaccggataatcagcccctgaag
actccatgcttcacccttcattatgccgccccagagctcttgaatcagaacggctacgat
gagtcctgtgacctgtggagcttgggcgtcattttgtacacaatgttgtcaggacaggtt
cccttccaatctcatgaccgaagtttgacgtgtaccagcgcggtggaaatcatgaagaaa
attaaaaagggagatttctcctttgaaggagaagcctggaagaatgtatcccaagaggct
aaagatttgatccaaggacttctcacagtagatccaaacaaaaggcttaaaatgtctggc
ttgaggtacaatgaatggctacaagatggaagtcagctgtcctccaatcctctgatgact
ccggatattctaggatcttccggagctgccgtgcatacctgtgtgaaagcaaccttccac
gcctttaacaaatacaagagagaggggttttgccttcagaatgttgataaggcccctttg
gctaagagaagaaaaatgaaaaagactagcaccagtaccgagacgcgcagcagttccagt
gagagttcccattcttcttcctctcattctcacggtaaaactacacccaccaagacactg
cagcccagcaatcctgccgacagcaataacccggagaccctcttccagttctcggactca
gtagcttag

DBGET integrated database retrieval system