KEGG   Homo sapiens (human): 9253Help
Entry
9253              CDS       T01001                                 

Gene name
NUMBL, CAG3A, CTG3a, NBL, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Definition
numb homolog (Drosophila)-like
Orthology
K06057  
numb
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    9253 (NUMBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.13-q13.2
AA seq 568 aa AA seqDB search
MNKLRQSLRRRKPAYVPEASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCED
AVKKLKAMGRKSVKSVLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYIC
RDGTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRREKECGVTAAFDASRTSFAR
EGSFRLSGGGRPAEREAPDKKKAEAAAAPTVAPGPAQPGHVSPTPATTSPGEKGEAGTPV
AAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQ
VKGTVPEMEPPGAGDSDSINALCTQISSSFASAGAPAPGPPPATTGTSAWGEPSVPPAAA
FQPGHKRTPSEAERWLEEVSQVAKAQQQQQQQQQQQQQQQQQQQQAASVAPVPTMPPALQ
PFPAPVGPFDAAPAQVAVFLPPPHMQPPFVPAYPGLGYPPMPRVPVVGITPSQMVANAFC
SAAQLQPQPATLLGKAGAFPPPAIPSAPGSQARPRPNGAPWPPEPAPAPAPELDPFEAQW
AALEGKATVEKPSNPFSGDLQKTFEIEL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttacggcagagcctgcggcggaggaagccagcctacgtgcccgaggcgtcg
cgcccgcaccagtggcaggcagacgaggacgcggtgcggaagggcacgtgcagcttcccg
gtcaggtacctgggtcacgtggaggtagaggagtcccggggaatgcacgtgtgtgaagat
gcggtgaagaagctgaaggcgatgggccgaaagtccgtgaagtctgtcctgtgggtgtca
gccgatgggctccgagtggtggacgacaaaaccaaggatcttctggtcgaccagaccatc
gaaaaggtctccttttgtgctcctgaccgcaacctggacaaggctttctcctatatctgt
cgtgacgggactacccgccgctggatctgccactgttttctggcactgaaggactccggc
gagaggctgagccacgctgtgggctgtgcttttgccgcctgcctggagcgaaaacagcga
cgggagaaggaatgtggggtcacggccgccttcgatgccagccgcaccagcttcgcccgc
gagggctccttccgcctgtctgggggtgggcggcctgctgagcgagaggccccggacaag
aagaaagcagaggcagcagctgcccccactgtggctcctggccctgcccagcctgggcac
gtgtccccgacaccagccaccacatcccctggtgagaagggtgaggcaggcacccctgtg
gctgcaggcaccactgcggccgccatcccccggcgccatgcacccctggagcagctggtt
cgccagggctccttccgtgggttcccagcactcagccagaagaactcgcctttcaaacgg
cagctgagcctacggctgaatgagctgccatccacgctgcagcgccgcactgacttccag
gtgaagggcacagtgcctgagatggagcctcctggtgccggcgacagtgacagcatcaac
gctctgtgcacacagatcagttcatcttttgccagtgctggagcgccagcaccagggcca
ccacctgccacaacagggacttctgcctggggtgagccctccgtgccccctgcagctgcc
ttccagcctgggcacaagcggacaccttcagaggctgagcgatggctggaggaggtgtca
caggtggccaaggcccagcagcagcagcagcagcaacagcaacagcagcagcagcagcag
cagcaacagcagcaagcagcctcagtggccccagtgcccaccatgcctcctgccctgcag
cctttccccgcccccgtggggccctttgacgctgcacctgcccaagtggccgtgttcctg
ccacccccacacatgcagcccccttttgtgcccgcctacccgggcttgggctacccaccg
atgccccgggtgcccgtggtgggcatcacaccctcacagatggtggcaaacgccttctgc
tcagccgcccagctccagcctcagcctgccactctgcttgggaaagctggggccttcccg
ccccctgccatacccagtgcccctgggagccaggcccgccctcgccccaatggggccccc
tggccccctgagccagcgcctgccccagctccagagttggacccctttgaggcccagtgg
gcggcattagaaggcaaagccactgtagagaaaccctccaaccccttttctggcgacctg
caaaagacattcgagattgaactgtag

DBGET integrated database retrieval system