KEGG   Homo sapiens (human): 9253Help
Entry
9253              CDS       T01001                                 

Gene name
NUMBL, CAG3A, CTG3a, NBL, NUMB-R, NUMBLIKE, NUMBR, TNRC23
Definition
numb homolog (Drosophila)-like
Orthology
K06057  
numb
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.13-q13.2
AA seq 609 aa AA seqDB search
MSRSAAASGGPRRPERHLPPAPCGAPGPPETCRTEPDGAGTMNKLRQSLRRRKPAYVPEA
SRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWV
SADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDS
GERLSHAVGCAFAACLERKQRREKECGVTAAFDASRTSFAREGSFRLSGGGRPAEREAPD
KKKAEAAAAPTVAPGPAQPGHVSPTPATTSPGEKGEAGTPVAAGTTAAAIPRRHAPLEQL
VRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDFQVKGTVPEMEPPGAGDSDSI
NALCTQISSSFASAGAPAPGPPPATTGTSAWGEPSVPPAAAFQPGHKRTPSEAERWLEEV
SQVAKAQQQQQQQQQQQQQQQQQQQQAASVAPVPTMPPALQPFPAPVGPFDAAPAQVAVF
LPPPHMQPPFVPAYPGLGYPPMPRVPVVGITPSQMVANAFCSAAQLQPQPATLLGKAGAF
PPPAIPSAPGSQARPRPNGAPWPPEPAPAPAPELDPFEAQWAALEGKATVEKPSNPFSGD
LQKTFEIEL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcagcgcggcggccagcggcggaccccggaggcctgagcggcacctgccccca
gccccctgtggggccccggggcccccagaaacctgcaggacggagccagacggggcgggc
accatgaacaagttacggcagagcctgcggcggaggaagccagcctacgtgcccgaggcg
tcgcgcccgcaccagtggcaggcagacgaggacgcggtgcggaagggcacgtgcagcttc
ccggtcaggtacctgggtcacgtggaggtagaggagtcccggggaatgcacgtgtgtgaa
gatgcggtgaagaagctgaaggcgatgggccgaaagtccgtgaagtctgtcctgtgggtg
tcagccgatgggctccgagtggtggacgacaaaaccaaggatcttctggtcgaccagacc
atcgaaaaggtctccttttgtgctcctgaccgcaacctggacaaggctttctcctatatc
tgtcgtgacgggactacccgccgctggatctgccactgttttctggcactgaaggactcc
ggcgagaggctgagccacgctgtgggctgtgcttttgccgcctgcctggagcgaaaacag
cgacgggagaaggaatgtggggtcacggccgccttcgatgccagccgcaccagcttcgcc
cgcgagggctccttccgcctgtctgggggtgggcggcctgctgagcgagaggccccggac
aagaagaaagcagaggcagcagctgcccccactgtggctcctggccctgcccagcctggg
cacgtgtccccgacaccagccaccacatcccctggtgagaagggtgaggcaggcacccct
gtggctgcaggcaccactgcggccgccatcccccggcgccatgcacccctggagcagctg
gttcgccagggctccttccgtgggttcccagcactcagccagaagaactcgcctttcaaa
cggcagctgagcctacggctgaatgagctgccatccacgctgcagcgccgcactgacttc
caggtgaagggcacagtgcctgagatggagcctcctggtgccggcgacagtgacagcatc
aacgctctgtgcacacagatcagttcatcttttgccagtgctggagcgccagcaccaggg
ccaccacctgccacaacagggacttctgcctggggtgagccctccgtgccccctgcagct
gccttccagcctgggcacaagcggacaccttcagaggctgagcgatggctggaggaggtg
tcacaggtggccaaggcccagcagcagcagcagcagcaacagcaacagcagcagcagcag
cagcagcaacagcagcaagcagcctcagtggccccagtgcccaccatgcctcctgccctg
cagcctttccccgcccccgtggggccctttgacgctgcacctgcccaagtggccgtgttc
ctgccacccccacacatgcagcccccttttgtgcccgcctacccgggcttgggctaccca
ccgatgccccgggtgcccgtggtgggcatcacaccctcacagatggtggcaaacgccttc
tgctcagccgcccagctccagcctcagcctgccactctgcttgggaaagctggggccttc
ccgccccctgccatacccagtgcccctgggagccaggcccgccctcgccccaatggggcc
ccctggccccctgagccagcgcctgccccagctccagagttggacccctttgaggcccag
tgggcggcattagaaggcaaagccactgtagagaaaccctccaaccccttttctggcgac
ctgcaaaagacattcgagattgaactgtag

DBGET integrated database retrieval system