KEGG   Homo sapiens (human): 9254Help
Entry
9254              CDS       T01001                                 

Gene name
CACNA2D2, CACNA2D
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit alpha2delta 2
  KO
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Gabapentin: 
Gabapentin (DG01245): 
Mirogabalin besylate: 
Pregabalin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    9254 (CACNA2D2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    9254 (CACNA2D2)
  Circulatory system
   04260 Cardiac muscle contraction
    9254 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    9254 (CACNA2D2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    9254 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    9254 (CACNA2D2)
   05414 Dilated cardiomyopathy (DCM)
    9254 (CACNA2D2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   9254 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 1150 aa AA seqDB search
MAVPARTCGASRPGPARTARPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGAS
AYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVA
GDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVER
GSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRR
QDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSG
SVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAV
QGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRT
VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEA
KQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPN
YTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGN
KGHKQIRTLVKSLDERYIDEVTRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQV
KLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSK
QCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAEDWTE
NPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGRRTLRPA
VVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLV
LSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVF
VPTVADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMKQTQY
YFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGP
EQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQP
QVLVHASRRL
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcctctcggcccggcccagcgcggactgcgcgc
ccctggcccggctgcggcccccaccctggccccggcacccggcgcccgacgtccgggccc
ccgcgcccgctgtggctgctgctgccgcttctaccgctgctcgccgcccccggcgcctct
gcctacagcttcccccagcagcacacgatgcagcactgggcccggcgtctggagcaggag
gtcgacggcgtgatgcggatttttggaggcgtccagcagctccgtgagatttacaaggac
aaccggaacctgttcgaggtacaggagaatgagcctcagaagttggtggagaaggtggca
ggggacattgagagccttctggacaggaaggtgcaggccctgaagagactggctgatgct
gcagagaacttccagaaagcacaccgctggcaggacaacatcaaggaggaagacatcgtg
tactatgacgccaaggctgacgctgagctggacgaccctgagagtgaggatgtggaaagg
gggtctaaggccagcaccctaaggctggacttcatcgaggacccaaacttcaagaacaag
gtcaactattcatacgcggctgtacagatccctacggacatctacaaaggctccactgtc
atcctcaatgagctcaactggacagaggccctggagaatgtgttcatggaaaaccgcaga
caagaccccacactgctgtggcaggtcttcggcagcgccacaggagtcactcgctactac
ccggccaccccgtggcgagcccccaagaagatcgacctgtacgatgtccgaaggagaccc
tggtatatccagggggcctcgtcacccaaagacatggtcatcatcgtggatgtgagtggc
agtgtgagcggcctgaccctgaagctgatgaagacatctgtctgcgagatgctggacacg
ctgtctgatgatgactatgtgaatgtggcctcgttcaacgagaaggcacagcctgtgtca
tgcttcacacacctggtgcaggccaatgtgcgcaacaagaaggtgttcaaggaagctgtg
cagggcatggtggccaagggcaccacaggctacaaggccggctttgagtatgcctttgac
cagctgcagaactccaacatcactcgggccaactgcaacaagatgatcatgatgttcacg
gatggtggtgaggaccgcgtgcaggacgtctttgagaagtacaattggccaaaccggacg
gtgcgcgtgtttactttctccgtggggcagcataactatgacgtcacaccgctgcagtgg
atggcctgtgccaacaaaggctactattttgagatcccttccatcggagccatccgcatc
aacacacaggaatatctagatgtgttgggcaggcccatggtgctggcaggcaaggaggcc
aagcaggtgcagtggaccaacgtgtatgaggatgcactgggactggggttggtggtaaca
gggaccctccctgttttcaacctgacacaggatggccctggggaaaagaagaaccagctg
atcctgggcgtgatgggcattgacgtggctctgaatgacatcaagaggctgacccccaac
tacacgcttggagccaacggctatgtgtttgccattgacctgaacggctacgtgttgctg
caccccaatctcaagccccagaccaccaacttccgggagcctgtgactctggacttcctg
gatgcggagctagaggatgagaacaaggaagagatccgtcggagcatgattgatggcaac
aagggccacaagcagatcagaacgttggtcaagtccctggatgagaggtacatagatgag
gtgacacggaactacacctgggtgcctataaggagcactaactacagcctggggctggtg
ctcccaccctacagcaccttctacctccaagccaatctcagtgaccagatcctgcaggtc
aagttgccaatcagcaaactgaaggattttgagttcctgctccccagcagctttgagtct
gaaggacacgttttcattgctcccagagagtactgcaaggacctgaatgcctcagacaac
aacaccgagttcctgaaaaactttattgagctcatggagaaagtgactccagactccaag
cagtgcaacaacttccttctgcacaacctgatcttggacacgggcatcacgcagcagctg
gtagagcgtgtgtggagggaccaggatctcaacacgtacagcctactggccgtgttcgct
gccacagacggtggcatcacccgagtcttccccaacaaggcagctgaggactggacagag
aaccctgagcccttcaatgccagcttctaccgccgcagcctggataaccacggttatgtc
ttcaagcccccacaccaggatgccctgttaaggccgctggagctggagaatgacactgtg
ggcatcctcgtcagcacagctgtggagctcagcctaggcaggcgcacactgaggccagca
gtggtgggcgtcaagctggacctagaggcttgggctgagaagttcaaggtgctagccagc
aaccgtacccaccaagaccagcctcagaagtgcggccccaacagccactgtgagatggac
tgcgaggttaacaatgaggacttactctgtgtcctcattgatgatggaggattcctggtg
ctgtcaaaccagaaccatcagtgggaccaggtgggcaggttcttcagtgaggtggatgcc
aacctgatgctggcactctacaataactccttctacacccgcaaggagtcctatgactat
caggcagcctgtgcccctcagccccctggcaacctgggtgctgcaccccggggtgtcttt
gtgcccaccgttgcagatttccttaacctggcctggtggacctctgctgccgcctggtcc
ctgttccagcagcttctctacggcctcatctaccacagctggttccaagcagaccccgcg
gaggccgaggggagccccgagacgcgcgagagcagctgcgtcatgaaacagacccagtac
tacttcggctcggtaaacgcctcctacaacgccatcatcgactgcggaaactgctccagg
ctgttccacgcgcagagactgaccaacaccaatcttctctttgtggtggccgagaagccg
ctgtgcagccagtgcgaggctggccggctgctgcagaaggagacgcactcggacggcccg
gagcagtgtgagctagtgcagagaccgcgataccggagaggcccgcacatctgcttcgac
tacaacgcgacagaagatacctcagactgtggccgcggggcctccttcccgccgtcgctg
ggcgtcctggtctccctgcaactgctgctcctcctgggcctgccgccccggccgcagcct
caagtcctcgtccacgcctctcgccgcctctga

DBGET integrated database retrieval system