KEGG   Homo sapiens (human): 92552Help
Entry
92552             CDS       T01001                                 

Gene name
ATXN3L, MJDL
Definition
ataxin 3-like (EC:3.4.19.12)
Orthology
K11863  
Ataxin-3 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    92552 (ATXN3L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     92552 (ATXN3L)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C86
   92552 (ATXN3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.2
AA seq 355 aa AA seqDB search
MDFIFHEKQEGFLCAQHCLNNLLQGEYFSPVELASIAHQLDEEERMRMAEGGVTSEEYLA
FLQQPSENMDDTGFFSIQVISNALKFWGLEIIHFNNPEYQKLGIDPINERSFICNYKQHW
FTIRKFGKHWFNLNSLLAGPELISDTCLANFLARLQQQAYSVFVVKGDLPDCEADQLLQI
ISVEEMDTPKLNGKKLVKQKEHRVYKTVLEKVSEESDESGTSDQDEEDFQRALELSRQET
NREDEHLRSTIELSMQGSSGNTSQDLPKTSCVTPASEQPKKIKEDYFEKHQQEQKQQQQQ
SDLPGHSSYLHERPTTSSRAIESDLSDDISEGTVQAAVDTILEIMRKNLKIKGEK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttcatctttcatgagaaacaggaaggtttcctgtgtgctcagcactgtctgaac
aatctattgcaaggagaatattttagccctgtggaattagcctcaattgcacatcagcta
gatgaagaagagaggatgagaatggcagaaggaggagtcaccagtgaagagtatcttgca
tttttacagcagccttcagaaaacatggatgataccggtttcttctccattcaggtaata
agcaatgccttgaagttctggggtttagagatcatccatttcaataatcctgaatatcag
aagctcggcattgatcctataaatgaaagatcttttatatgtaattataaacaacactgg
tttactattagaaaatttggaaaacactggtttaacttgaattctctcttggcgggtcca
gaattaatatcagatacatgccttgcaaatttcttggctcgattacaacaacaagcatat
tctgtatttgttgtcaagggtgatctgccagactgtgaagctgaccaactcctgcagatc
atcagtgtcgaagagatggatacaccaaaacttaatggaaaaaaattagtaaaacaaaaa
gagcatagagtctataaaacagtccttgaaaaagtatcagaagaaagtgatgagtctgga
acatcagaccaagatgaggaggattttcagagggcccttgaactaagccgccaagaaacc
aatagagaagatgaacatctccgcagtactattgagttaagcatgcaaggtagttccgga
aacacatcgcaagatcttccaaagacatcatgtgtaactcctgcttcagaacagccgaag
aaaataaaagaagactattttgaaaagcatcagcaggaacagaagcagcagcaacaacag
tcagatctgccgggccacagttcatacctacacgaaaggccaacaacaagttcgagagca
attgagagtgatctcagtgatgacatcagtgaaggcacagtacaggccgctgtcgacacc
attttagaaattatgagaaagaatttgaaaatcaaaggggaaaaataa

DBGET integrated database retrieval system