KEGG   Homo sapiens (human): 92609Help
Entry
92609             CDS       T01001                                 

Gene name
TIMM50, TIM50, TIM50L
Definition
(RefSeq) translocase of inner mitochondrial membrane 50
  KO
K17496  
mitochondrial import inner membrane translocase subunit TIM50
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    92609 (TIMM50)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   92609 (TIMM50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 456 aa AA seqDB search
MASALSLGNKCDPFLRCVLCRGGGALQGPRGRGPDDFESQLSPPGSARRLVRSKRACGNP
PDAFGLSRASVHPPLPRVSIGCSSGPGRAKRERVGGAAWRQRKMAASAAVFSRLRSGLRL
GSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAG
GTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPD
PLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSET
GMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQ
PYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSR
LEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagctttatctctgggcaataagtgtgatcccttccttcgctgcgtcctttgc
aggggcggtggcgctctgcaaggcccaagggggcgtggtccagatgactttgaatcccag
ttgtcgcccccagggtcagccaggagactagtcagaagcaaacgcgcctgcggcaatccg
cccgatgcctttggtctctctcgggcttccgtccacccgcccctcccccgcgtttccatt
ggctgtagctccggcccggggcgggcgaagagggagcgagtgggcggggccgcgtggcgt
cagcgcaagatggcggcctcggcagcggtgttctcgcgcttgcgaagcgggctccggctc
ggctcgcggggactgtgcacgaggttggcgacgccgccccgccgggccccagatcaggcc
gcagagatcgggagccgcgggagcactaaggcgcaagggccacagcagcagccgggctca
gagggtcccagctatgccaaaaaagttgcgctctggcttgctgggctgcttggagctggt
gggactgtgagcgtcgtctatatctttggaaacaacccggtggacgaaaatggtgccaag
attcctgatgagttcgacaatgatccaattctggtacagcagttgcgccggacatacaaa
tatttcaaagattatagacagatgatcatcgagcccaccagcccttgccttctcccagac
cctctgcaggaaccgtactaccagccaccctacacgctcgttttggagctcaccggcgtc
ctcttgcatcctgagtggtcgctggccactggctggaggtttaagaagcgcccaggcatc
gagaccttgttccagcagcttgcccctttatatgaaattgtcatctttacgtcagagact
ggcatgactgcgtttccactcattgatagtgtggacccccatggcttcatctcctaccgc
ctattccgggacgccacaagatacatggatggacaccatgtaaaggatatttcatgtctg
aatcgggacccagctcgagtagtagttgtggactgcaagaaggaagccttccgcctgcag
ccctataacggcgttgccctgcggccctgggacggcaactctgatgaccgggtcttgttg
gatctgtctgccttcctcaagaccattgcactgaatggtgtggaggacgtgcgaaccgtg
ctggagcactatgccctggaggatgacccgctggcggctttcaaacagcggcaaagccgg
ctagagcaggaggagcagcagcgcctggccgagctctccaagtccaacaagcagaacctc
ttccttggctccctcaccagccgcttgtggcctcgctccaaacagccctga

DBGET integrated database retrieval system