KEGG   Homo sapiens (human): 9261Help
Entry
9261              CDS       T01001                                 

Gene name
MAPKAPK2, MAPKAP-K2, MK-2, MK2
Definition
mitogen-activated protein kinase-activated protein kinase 2 (EC:2.7.11.1)
Orthology
K04443  
mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
VEGF signaling pathway
Neurotrophin signaling pathway
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 370 aa AA seqDB search
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKGCLHDKN
SDQATWLTRL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaactcccagggccagagcccgccggtgccgttccccgccccggccccgccg
ccgcagccccccacccctgccctgccgcaccccccggcgcagccgccgccgccgcccccg
cagcagttcccgcagttccacgtcaagtccggcctgcagatcaagaagaacgccatcatc
gatgactacaaggtcaccagccaggtcctggggctgggcatcaacggcaaagttttgcag
atcttcaacaagaggacccaggagaaattcgccctcaaaatgcttcaggactgccccaag
gcccgcagggaggtggagctgcactggcgggcctcccagtgcccgcacatcgtacggatc
gtggatgtgtacgagaatctgtacgcagggaggaagtgcctgctgattgtcatggaatgt
ttggacggtggagaactctttagccgaatccaggatcgaggagaccaggcattcacagaa
agagaagcatccgaaatcatgaagagcatcggtgaggccatccagtatctgcattcaatc
aacattgcccatcgggatgtcaagcctgagaatctcttatacacctccaaaaggcccaac
gccatcctgaaactcactgactttggctttgccaaggaaaccaccagccacaactctttg
accactccttgttatacaccgtactatgtggctccagaagtgctgggtccagagaagtat
gacaagtcctgtgacatgtggtccctgggtgtcatcatgtacatcctgctgtgtgggtat
ccccccttctactccaaccacggccttgccatctctccgggcatgaagactcgcatccga
atgggccagtatgaatttcccaacccagaatggtcagaagtatcagaggaagtgaagatg
ctcattcggaatctgctgaaaacagagcccacccagagaatgaccatcaccgagtttatg
aaccacccttggatcatgcaatcaacaaaggtccctcaaaccccactgcacaccagccgg
gtcctgaaggaggacaaggagcggtgggaggatgtcaaggggtgtcttcatgacaagaac
agcgaccaggccacttggctgaccaggttgtga

DBGET integrated database retrieval system