KEGG   Homo sapiens (human): 9261Help
Entry
9261              CDS       T01001                                 

Gene name
MAPKAPK2, MAPKAP-K2, MK-2, MK2
Definition
mitogen-activated protein kinase-activated protein kinase 2 (EC:2.7.11.1)
Orthology
K04443  
mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
VEGF signaling pathway
Neurotrophin signaling pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    9261 (MAPKAPK2)
   04370 VEGF signaling pathway
    9261 (MAPKAPK2)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    9261 (MAPKAPK2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    9261 (MAPKAPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9261 (MAPKAPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MAPKAPK family [OT]
   9261 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 370 aa AA seqDB search
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKGCLHDKN
SDQATWLTRL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaactcccagggccagagcccgccggtgccgttccccgccccggccccgccg
ccgcagccccccacccctgccctgccgcaccccccggcgcagccgccgccgccgcccccg
cagcagttcccgcagttccacgtcaagtccggcctgcagatcaagaagaacgccatcatc
gatgactacaaggtcaccagccaggtcctggggctgggcatcaacggcaaagttttgcag
atcttcaacaagaggacccaggagaaattcgccctcaaaatgcttcaggactgccccaag
gcccgcagggaggtggagctgcactggcgggcctcccagtgcccgcacatcgtacggatc
gtggatgtgtacgagaatctgtacgcagggaggaagtgcctgctgattgtcatggaatgt
ttggacggtggagaactctttagccgaatccaggatcgaggagaccaggcattcacagaa
agagaagcatccgaaatcatgaagagcatcggtgaggccatccagtatctgcattcaatc
aacattgcccatcgggatgtcaagcctgagaatctcttatacacctccaaaaggcccaac
gccatcctgaaactcactgactttggctttgccaaggaaaccaccagccacaactctttg
accactccttgttatacaccgtactatgtggctccagaagtgctgggtccagagaagtat
gacaagtcctgtgacatgtggtccctgggtgtcatcatgtacatcctgctgtgtgggtat
ccccccttctactccaaccacggccttgccatctctccgggcatgaagactcgcatccga
atgggccagtatgaatttcccaacccagaatggtcagaagtatcagaggaagtgaagatg
ctcattcggaatctgctgaaaacagagcccacccagagaatgaccatcaccgagtttatg
aaccacccttggatcatgcaatcaacaaaggtccctcaaaccccactgcacaccagccgg
gtcctgaaggaggacaaggagcggtgggaggatgtcaaggggtgtcttcatgacaagaac
agcgaccaggccacttggctgaccaggttgtga

DBGET integrated database retrieval system