KEGG   Homo sapiens (human): 9262Help
Entry
9262              CDS       T01001                                 

Gene name
STK17B, DRAK2
Definition
(RefSeq) serine/threonine kinase 17b
  KO
K08804  serine/threonine kinase 17 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9262 (STK17B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   9262 (STK17B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH DUF2201_N
Motif
Other DBs
NCBI-GeneID: 9262
NCBI-ProteinID: NP_004217
OMIM: 604727
HGNC: 11396
Ensembl: ENSG00000081320
Vega: OTTHUMG00000132735
Pharos: O94768(Tchem)
UniProt: O94768 Q53QE7
Structure
PDB: 

Jmol
Position
2q32.3
AA seq 372 aa AA seqDB search
MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYA
AKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFS
LCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDF
GMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDN
QETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFEN
LFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSL
PNPHELVSDLLC
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggaggagatttgattgccgaagtatttcaggcctactaactacaactcctcaa
attccaataaaaatggaaaactttaataatttctatatacttacatctaaagagctaggg
agaggaaaatttgctgtggttagacaatgtatatcaaaatctactggccaagaatatgct
gcaaaatttctaaaaaagagaagaagaggacaggattgtcgagcagaaattttacacgag
attgctgtgcttgaattggcaaagtcttgtccccgtgttattaatcttcatgaggtctat
gaaaatacaagtgaaatcattttgatattggaatatgctgcaggtggagaaattttcagc
ctgtgtttacctgagttggctgaaatggtttctgaaaatgatgttatcagactcattaaa
caaatacttgaaggagtttattatctacatcagaataacattgtacaccttgatttaaag
ccacagaatatattactgagcagcatataccctctcggggacattaaaatagtagatttt
ggaatgtctcgaaaaatagggcatgcgtgtgaacttcgggaaatcatgggaacaccagaa
tatttagctccagaaatcctgaactatgatcccattaccacagcaacagatatgtggaat
attggtataatagcatatatgttgttaactcacacatcaccatttgtgggagaagataat
caagaaacatacctcaatatttctcaagttaatgtagattattcggaagaaactttttca
tcagtttcacagctggccacagactttattcagagccttttagtaaaaaatccagagaaa
agaccaacagcagagatatgcctttctcattcttggctacagcagtgggactttgaaaac
ttgtttcaccctgaagaaacttccagttcctctcaaactcaggatcattctgtaaggtcc
tctgaagacaagacttctaaatcctcctgtaatggaacctgtggtgatagagaagacaaa
gagaatatcccagaggatagcagcatggtttccaaaagatttcgtttcgatgactcatta
cccaatccccatgaacttgtttcagatttgctctgttag

DBGET integrated database retrieval system