KEGG   Homo sapiens (human): 92856Help
Entry
92856             CDS       T01001                                 

Gene name
IMP4, BXDC4
Definition
IMP4, U3 small nucleolar ribonucleoprotein
Orthology
K14561  
U3 small nucleolar ribonucleoprotein protein IMP4
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    92856 (IMP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q21.1
AA seq 291 aa AA seqDB search
MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFD
DAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHE
VGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMS
EAKPHLITHGFSSRLGKRVSDILRYLFPVPKDDSHRVITFANQDDYISFRHHVYKKTDHR
NVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVFLSTE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgaggcccgcctgcgccgcgagtacctgtaccgcaaggcccgggaggag
gcgcagcgctcagcccaggagaggaaggagcggctgcggcgcgcgctggaagaaaaccgc
ctgattcccactgagttacgccgagaggctctggccttacaggggtccctggagtttgat
gatgctggaggtgaaggtgtgaccagccacgtggatgatgaataccgatgggcaggagtc
gaggatcccaaggttatgatcactacctcccgagaccccagttcccgcctcaagatgttt
gcaaaggagctgaagctggtgttcccgggcgcccagcgaatgaaccgaggtcgacatgaa
gtgggggcactggtgcgagcctgcaaagccaacggcgtcaccgatctgctggtcgttcac
gagcatcggggcacacctgtggggctcatcgtcagccacctgccctttggtcctactgcc
tacttcacgctgtgcaatgtggtcatgcggcatgacatcccagacctgggcaccatgtcg
gaggccaagccccacctcatcacacacggcttctcctcccgcctgggcaagcgggtctct
gacatcctccgatacctatttcccgtgcccaaagatgacagccaccgggtcatcaccttc
gcaaaccaggacgactacatatcattccggcaccatgtgtataagaagacagaccaccgc
aacgtggagctcactgaggtcgggccccgctttgagctgaagctgtacatgatccgtctg
ggcacgctggagcaggaggccacagcagacgtggagtggcgctggcacccttacaccaat
accgcacgcaagagagtcttcctgagcaccgagtga

DBGET integrated database retrieval system