KEGG   Homo sapiens (human): 9287Help
Entry
9287              CDS       T01001                                 

Gene name
TAAR2, GPR58, taR-2
Definition
(RefSeq) trace amine associated receptor 2 (gene/pseudogene)
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9287 (TAAR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Trace amine
    9287 (TAAR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 YWFCY
Motif
Other DBs
NCBI-GeneID: 9287
NCBI-ProteinID: NP_001028252
OMIM: 604849
HGNC: 4514
Ensembl: ENSG00000146378
Vega: OTTHUMG00000015585
Pharos: Q9P1P5(Tdark)
UniProt: Q9P1P5
Position
6q23.2
AA seq 351 aa AA seqDB search
MAVSSEQHELSHFKRTQTKKEKFNCSEYGNRSCPENERSLGVRVAMYSFMAGSIFITIFG
NLAMIISISYFKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVENCWYFGLTFCKIYY
SFDLMLSITSIFHLCSVAIDRFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGVVF
SEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIFAVSRKHA
HAINNLRENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLFDAL
TWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSSCFHNTILCMQKESE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggctgtctcatcagagcaacatgaactttcacatttcaaaagaacacagacaaaaaag
gaaaaattcaattgctctgaatatggaaatagatcttgcccagaaaatgaaagatctctg
ggtgtccgagtggctatgtattcatttatggcaggatccatattcatcacaatatttggc
aatcttgccatgataatttccatttcctacttcaagcagcttcacacaccaaccaacttc
ctcatcctctccatggccatcactgatttcctcctgggattcaccatcatgccatatagt
atgatcagatcggtggagaactgctggtattttgggcttacattttgcaagatttattat
agttttgacctgatgcttagcataacatccatttttcatctttgctcagtggccattgat
agattttatgctatatgttacccattactttattccaccaaaataactattccagtcatt
aaaagattgctacttctatgttggtcggtccctggagcatttgccttcggggtggtcttc
tcagaggcctatgcagatggaatagagggctatgacatcttggttgcttgttccagttcc
tgcccagtgatgttcaacaagctatgggggaccaccttgtttatggcaggtttcttcact
cctgggtctatgatggtggggatttatggcaaaatttttgcagtatccagaaaacatgct
catgccatcaataacttgcgagaaaatcaaaataatcaagtgaagaaagacaaaaaagct
gccaaaactttaggaatagtgataggagttttcttattatgttggtttccttgtttcttc
acaattttattggatccctttttgaacttctctactcctgtagttttgtttgatgccttg
acatggtttggctattttaactccacatgtaatccgttaatatatggtttcttctatccc
tggtttcgcagagcactgaagtacattttgctaggtaaaattttcagctcatgtttccat
aatactattttgtgtatgcaaaaagaaagtgagtag

DBGET integrated database retrieval system