KEGG   Homo sapiens (human): 9289Help
Entry
9289              CDS       T01001                                 

Gene name
ADGRG1, BFPP, BPPR, GPR56, TM7LN4, TM7XN1
Definition
(RefSeq) adhesion G protein-coupled receptor G1
  KO
K08450  
G protein-coupled receptor 56
Organism
hsa  Homo sapiens (human)
Disease
H00271  
Polymicrogyria
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    9289 (ADGRG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q21
AA seq 693 aa AA seqDB search
MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIEN
SEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLL
CFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELK
RDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKL
QPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQ
DKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGH
WSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV
TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAI
FLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVD
NYGPIILAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLR
PHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWS
MRLQARGGPSPLKSNSDSARLPISSGSTSSSRI
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgactccccagtcgctgctgcagacgacactgttcctgctgagtctgctcttcctggtc
caaggtgcccacggcaggggccacagggaagactttcgcttctgcagccagcggaaccag
acacacaggagcagcctccactacaaacccacaccagacctgcgcatctccatcgagaac
tccgaagaggccctcacagtccatgcccctttccctgcagcccaccctgcttcccgatcc
ttccctgaccccaggggcctctaccacttctgcctctactggaaccgacatgctgggaga
ttacatcttctctatggcaagcgtgacttcttgctgagtgacaaagcctctagcctcctc
tgcttccagcaccaggaggagagcctggctcagggccccccgctgttagccacttctgtc
acctcctggtggagccctcagaacatcagcctgcccagtgccgccagcttcaccttctcc
ttccacagtcctccccacacggccgctcacaatgcctcggtggacatgtgcgagctcaaa
agggacctccagctgctcagccagttcctgaagcatccccagaaggcctcaaggaggccc
tcggctgcccccgccagccagcagttgcagagcctggagtcgaaactgacctctgtgaga
ttcatgggggacatggtgtccttcgaggaggaccggatcaacgccacggtgtggaagctc
cagcccacagccggcctccaggacctgcacatccactcccggcaggaggaggagcagagc
gagatcatggagtactcggtgctgctgcctcgaacactcttccagaggacgaaaggccgg
agcggggaggctgagaagagactcctcctggtggacttcagcagccaagccctgttccag
gacaagaattccagccaagtcctgggtgagaaggtcttggggattgtggtacagaacacc
aaagtagccaacctcacggagcccgtggtgctcactttccagcaccagctacagccgaag
aatgtgactctgcaatgtgtgttctgggttgaagaccccacattgagcagcccggggcat
tggagcagtgctgggtgtgagaccgtcaggagagaaacccaaacatcctgcttctgcaac
cacttgacctactttgcagtgctgatggtctcctcggtggaggtggacgccgtgcacaag
cactacctgagcctcctctcctacgtgggctgtgtcgtctctgccctggcctgccttgtc
accattgccgcctacctctgctccagggtgcccctgccgtgcaggaggaaacctcgggac
tacaccatcaaggtgcacatgaacctgctgctggccgtcttcctgctggacacgagcttc
ctgctcagcgagccggtggccctgacaggctctgaggctggctgccgagccagtgccatc
ttcctgcacttctccctgctcacctgcctttcctggatgggcctcgaggggtacaacctc
taccgactcgtggtggaggtctttggcacctatgtccctggctacctactcaagctgagc
gccatgggctggggcttccccatctttctggtgacgctggtggccctggtggatgtggac
aactatggccccatcatcttggctgtgcataggactccagagggcgtcatctacccttcc
atgtgctggatccgggactccctggtcagctacatcaccaacctgggcctcttcagcctg
gtgtttctgttcaacatggccatgctagccaccatggtggtgcagatcctgcggctgcgc
ccccacacccaaaagtggtcacatgtgctgacactgctgggcctcagcctggtccttggc
ctgccctgggccttgatcttcttctcctttgcttctggcaccttccagcttgtcgtcctc
taccttttcagcatcatcacctccttccaaggcttcctcatcttcatctggtactggtcc
atgcggctgcaggcccggggtggcccctcccctctgaagagcaactcagacagcgccagg
ctccccatcagctcgggcagcacctcgtccagccgcatctag

DBGET integrated database retrieval system