KEGG   Homo sapiens (human): 92912Help
Entry
92912             CDS       T01001                                 

Gene name
UBE2Q2
Definition
ubiquitin-conjugating enzyme E2Q family member 2 (EC:6.3.2.19)
Orthology
K10582  
ubiquitin-conjugating enzyme E2 Q [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q24.2
AA seq 359 aa AA seqDB search
MRMDSLTEEKLECRLWCCLSDPSPPGLAARCCVLERSIVPSLRQESYPSSSPIWFVDSED
PNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEV
TSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLN
GAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDL
QILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSA
YSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggactcgttgacggaggaaaagttggaatgcagactctggtgctgtttgagc
gacccctctcccccgggcctggctgcgcgctgctgtgttctggaaaggagcatagtaccg
tcgttgcggcaggaatcctatccatcttcttcaccgatatggtttgtggattctgaagac
ccaaatctgacatcagttctggaacgtctagaagatactaagaacaacaatttgcttcgt
cagcaattgaagtggttgatatgtgaactctgcagtttatataaccttcctaagcacctg
gatgttgagatgctagatcaaccactacccacgggtcagaatgggacaacagaagaagtg
acttcagaagaagaggaagaagaagaagagatggctgaagatatagaagacttagatcac
tatgagatgaaggaagaagagcctattagtgggaaaaagtcagaggatgaaggaattgaa
aaagaaaatttggcaatattagagaaaattaggaagactcaaaggcaagaccatttaaat
ggtgcagtgtctgggtcagtgcaagcttcagatagacttatgaaagagctcagggacata
tacagatcacagagttataaaacagggatttattcagtggaactcataaatgacagttta
tatgactggcatgttaaactgcagaaggttgaccctgatagtcctttgcacagtgatctt
cagatcttaaaagaaaaagaaggcatagaatatattttgcttaacttctcttttaaggat
aactttccatttgatcctccatttgttcgagtggtgttacctgttctctcaggagggtat
gtattgggtggaggagcattatgtatggaacttctcacaaaacagggctggagcagtgcc
tactcaatagaatcggtcatcatgcaaataaatgccaccttagtcaaaggcaaagccaga
gtgcagtttggagcaaataagaatcaatataatctagcaagagcccaacaatcctataat
tccattgtacagatacatgagaaaaatggctggtacacccctccaaaggaagatggctaa

DBGET integrated database retrieval system