KEGG   Homo sapiens (human): 92935Help
Entry
92935             CDS       T01001                                 

Gene name
MARS2, MetRS, mtMetRS
Definition
methionyl-tRNA synthetase 2, mitochondrial (EC:6.1.1.10)
Orthology
K01874  
methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
Selenocompound metabolism
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Disease
H01351  
Spastic ataxia (SPAX)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    92935 (MARS2)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    92935 (MARS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     92935 (MARS2)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   92935 (MARS2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    92935 (MARS2)
 Prokaryotic Type
   Other AARSs
    92935 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33.1
AA seq 593 aa AA seqDB search
MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHI
GHLYSALLADALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATAGLAPTELCDRVSEQ
FQQLFQEAGISCTDFIRTTEARHRVAVQHFWGVLKSRGLLYKGVYEGWYCASDECFLPEA
KVTQQPGPSGDSFPVSLESGHPVSWTKEENYIFRLSQFRKPLQRWLRGNPQAITPEPFHH
VVLQWLDEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIGYPNAEFKSW
WPATSHIIGKDILKFHAIYWPAFLLGAGMSPPQRICVHSHWTVCGQKMSKSLGNVVDPRT
CLNRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLNSELADALGGLLNRCTAKRINPSET
YPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCV
RQTNGFVQRHAPWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLG
VSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaacgtccgtcctccgcctgctaggacgcacgggggctagtaggctgtctctc
ctggaggacttcggcccacgctactacagttcgggctccctcagtgccggcgatgatgct
tgtgatgtgcgcgcctacttcactacacccattttctacgtgaacgcggcgccgcacatc
gggcacctgtactcggcactactggcggacgccctatgccgccaccgtcgcctccgaggt
cccagcacggccgccacgcgattctccactggtaccgacgagcacgggctgaagattcag
caggcagcagctaccgcgggcctggccccgaccgagctgtgcgaccgagtctctgagcag
ttccagcagcttttccaggaggccggtatctcctgcacagatttcatccgcaccacggag
gcccggcaccgggtggctgtgcagcacttctggggggtgcttaagtcccgcggtctgctc
tacaagggcgtctatgaaggttggtattgcgcttccgacgagtgcttcctgcctgaggcc
aaggtcacccagcagccgggcccatcgggggattcgtttcctgtatctctcgagagcggg
catccagtctcctggaccaaggaagaaaactacattttcaggctttcccagttccggaag
ccactccagcggtggctgcggggcaaccctcaggcgatcacccccgaaccatttcatcac
gtagttcttcagtggctggacgaggagctgcccgacctgtccgtgtctcgcagaagtagc
cacttgcactggggcattccggtgcccggggatgattcgcagaccatctatgtatggctg
gatgccctggtcaactacctcactgtaattggctacccaaatgctgagttcaaatcttgg
tggccggccacctctcatatcataggtaaggacattctcaaattccatgccatctattgg
cctgccttcctgttaggggccggcatgagcccgccacagcgcatctgtgtccattcccac
tggacagtctgtggccaaaagatgtccaagagcttgggcaacgtggtggatcctaggact
tgccttaaccgctataccgtggatggcttccgctactttctccttcggcagggcgtcccc
aactgggactgtgactactatgatgaaaaggtggttaagttgctgaactccgagctggca
gatgccttgggaggtctcttgaaccgatgcactgccaaaagaataaatccttctgagacc
tacccagccttctgcactacctgcttccctagtgagccagggttggtggggccgtcagtt
cgtgctcaggcagaggattatgctctggtgagcgcagtggccactttgccaaagcaggta
gcagaccactatgataactttcggatatataaggctctggaggccgtgtccagctgtgtc
cggcaaactaatggttttgtccaaaggcatgcaccatggaagctgaactgggagagccca
gtggatgctccctggctgggtactgtgcttcatgtggccttggaatgtttgcgagtcttt
gggactttgctgcagcctgtcaccccaagcctagctgacaagctgctgtctaggctgggg
gtctctgcctcagagaggagtcttggagagctctatttcttgcctcgattctatggacat
ccatgcccttttgaagggaggaggctgggacctgaaactgggcttttgtttccaagacta
gaccagtccaggacttggctggtgaaagcccaccggacctag

DBGET integrated database retrieval system