KEGG   Homo sapiens (human): 93Help
Entry
93                CDS       T01001                                 

Gene name
ACVR2B, ACTRIIB, ActR-IIB, HTX4
Definition
activin A receptor, type IIB (EC:2.7.11.30)
Orthology
K13596  
activin receptor type-2B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Disease
H00632  
Heterotaxy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    93 (ACVR2B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    93 (ACVR2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     93 (ACVR2B)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [Table]
   93 (ACVR2B)
Enzyme-linked receptors [BR:hsa01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   93 (ACVR2B)
Cytokine receptors [BR:hsa04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   93 (ACVR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22
AA seq 512 aa AA seqDB search
MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgccctgggtggccctcgccctcctctggggatcgctgtgcgccggctctggg
cgtggggaggctgagacacgggagtgcatctactacaacgccaactgggagctggagcgc
accaaccagagcggcctggagcgctgcgaaggcgagcaggacaagcggctgcactgctac
gcctcctggcgcaacagctctggcaccatcgagctcgtgaagaagggctgctggctagat
gacttcaactgctacgataggcaggagtgtgtggccactgaggagaacccccaggtgtac
ttctgctgctgtgaaggcaacttctgcaacgaacgcttcactcatttgccagaggctggg
ggcccggaagtcacgtacgagccacccccgacagcccccaccctgctcacggtgctggcc
tactcactgctgcccatcgggggcctttccctcatcgtcctgctggccttttggatgtac
cggcatcgcaagcccccctacggtcatgtggacatccatgaggaccctgggcctccacca
ccatcccctctggtgggcctgaagccactgcagctgctggagatcaaggctcgggggcgc
tttggctgtgtctggaaggcccagctcatgaatgactttgtagctgtcaagatcttccca
ctccaggacaagcagtcgtggcagagtgaacgggagatcttcagcacacctggcatgaag
cacgagaacctgctacagttcattgctgccgagaagcgaggctccaacctcgaagtagag
ctgtggctcatcacggccttccatgacaagggctccctcacggattacctcaaggggaac
atcatcacatggaacgaactgtgtcatgtagcagagacgatgtcacgaggcctctcatac
ctgcatgaggatgtgccctggtgccgtggcgagggccacaagccgtctattgcccacagg
gactttaaaagtaagaatgtattgctgaagagcgacctcacagccgtgctggctgacttt
ggcttggctgttcgatttgagccagggaaacctccaggggacacccacggacaggtaggc
acgagacggtacatggctcctgaggtgctcgagggagccatcaacttccagagagatgcc
ttcctgcgcattgacatgtatgccatggggttggtgctgtgggagcttgtgtctcgctgc
aaggctgcagacggacccgtggatgagtacatgctgccctttgaggaagagattggccag
cacccttcgttggaggagctgcaggaggtggtggtgcacaagaagatgaggcccaccatt
aaagatcactggttgaaacacccgggcctggcccagctttgtgtgaccatcgaggagtgc
tgggaccatgatgcagaggctcgcttgtccgcgggctgtgtggaggagcgggtgtccctg
attcggaggtcggtcaacggcactacctcggactgtctcgtttccctggtgacctctgtc
accaatgtggacctgccccctaaagagtcaagcatctaa

DBGET integrated database retrieval system