KEGG   Homo sapiens (human): 930Help
Entry
930               CDS       T01001                                 

Gene name
CD19, B4, CVID3
Definition
CD19 molecule
Orthology
K06465  
CD19 antigen
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
B cell receptor signaling pathway
Epstein-Barr virus infection
Primary immunodeficiency
Disease
H00088  
Common variable immunodeficiency (CVID)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    930 (CD19)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    930 (CD19)
   04662 B cell receptor signaling pathway
    930 (CD19)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    930 (CD19)
  Infectious diseases
   05169 Epstein-Barr virus infection
    930 (CD19)
Cellular antigens [BR:hsa04090]
 Proteins
  930 (CD19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 557 aa AA seqDB search
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
PHGSAWDPSREATSLAGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDG
PDPAWGGGGRMGTWSTR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgccacctcctcgcctcctcttcttcctcctcttcctcacccccatggaagtcaggccc
gaggaacctctagtggtgaaggtggaagagggagataacgctgtgctgcagtgcctcaag
gggacctcagatggccccactcagcagctgacctggtctcgggagtccccgcttaaaccc
ttcttaaaactcagcctggggctgccaggcctgggaatccacatgaggcccctggccatc
tggcttttcatcttcaacgtctctcaacagatggggggcttctacctgtgccagccgggg
cccccctctgagaaggcctggcagcctggctggacagtcaatgtggagggcagcggggag
ctgttccggtggaatgtttcggacctaggtggcctgggctgtggcctgaagaacaggtcc
tcagagggccccagctccccttccgggaagctcatgagccccaagctgtatgtgtgggcc
aaagaccgccctgagatctgggagggagagcctccgtgtctcccaccgagggacagcctg
aaccagagcctcagccaggacctcaccatggcccctggctccacactctggctgtcctgt
ggggtaccccctgactctgtgtccaggggccccctctcctggacccatgtgcaccccaag
gggcctaagtcattgctgagcctagagctgaaggacgatcgcccggccagagatatgtgg
gtaatggagacgggtctgttgttgccccgggccacagctcaagacgctggaaagtattat
tgtcaccgtggcaacctgaccatgtcattccacctggagatcactgctcggccagtacta
tggcactggctgctgaggactggtggctggaaggtctcagctgtgactttggcttatctg
atcttctgcctgtgttcccttgtgggcattcttcatcttcaaagagccctggtcctgagg
aggaaaagaaagcgaatgactgaccccaccaggagattcttcaaagtgacgcctccccca
ggaagcgggccccagaaccagtacgggaacgtgctgtctctccccacacccacctcaggc
ctcggacgcgcccagcgttgggccgcaggcctggggggcactgccccgtcttatggaaac
ccgagcagcgacgtccaggcggatggagccttggggtcccggagcccgccgggagtgggc
ccagaagaagaggaaggggagggctatgaggaacctgacagtgaggaggactccgagttc
tatgagaacgactccaaccttgggcaggaccagctctcccaggatggcagcggctacgag
aaccctgaggatgagcccctgggtcctgaggatgaagactccttctccaacgctgagtct
tatgagaacgaggatgaagagctgacccagccggtcgccaggacaatggacttcctgagc
cctcatgggtcagcctgggaccccagccgggaagcaacctccctggcagggtcccagtcc
tatgaggatatgagaggaatcctgtatgcagccccccagctccgctccattcggggccag
cctggacccaatcatgaggaagatgcagactcttatgagaacatggataatcccgatggg
ccagacccagcctggggaggagggggccgcatgggcacctggagcaccaggtga

DBGET integrated database retrieval system