KEGG   Homo sapiens (human): 930Help
Entry
930               CDS       T01001                                 

Gene name
CD19, B4, CVID3
Definition
CD19 molecule
Orthology
K06465  
CD19 antigen
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
B cell receptor signaling pathway
Epstein-Barr virus infection
Primary immunodeficiency
Disease
H00088  
Common variable immunodeficiency (CVID)
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 557 aa AA seqDB search
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
PHGSAWDPSREATSLAGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDG
PDPAWGGGGRMGTWSTR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgccacctcctcgcctcctcttcttcctcctcttcctcacccccatggaagtcaggccc
gaggaacctctagtggtgaaggtggaagagggagataacgctgtgctgcagtgcctcaag
gggacctcagatggccccactcagcagctgacctggtctcgggagtccccgcttaaaccc
ttcttaaaactcagcctggggctgccaggcctgggaatccacatgaggcccctggccatc
tggcttttcatcttcaacgtctctcaacagatggggggcttctacctgtgccagccgggg
cccccctctgagaaggcctggcagcctggctggacagtcaatgtggagggcagcggggag
ctgttccggtggaatgtttcggacctaggtggcctgggctgtggcctgaagaacaggtcc
tcagagggccccagctccccttccgggaagctcatgagccccaagctgtatgtgtgggcc
aaagaccgccctgagatctgggagggagagcctccgtgtctcccaccgagggacagcctg
aaccagagcctcagccaggacctcaccatggcccctggctccacactctggctgtcctgt
ggggtaccccctgactctgtgtccaggggccccctctcctggacccatgtgcaccccaag
gggcctaagtcattgctgagcctagagctgaaggacgatcgcccggccagagatatgtgg
gtaatggagacgggtctgttgttgccccgggccacagctcaagacgctggaaagtattat
tgtcaccgtggcaacctgaccatgtcattccacctggagatcactgctcggccagtacta
tggcactggctgctgaggactggtggctggaaggtctcagctgtgactttggcttatctg
atcttctgcctgtgttcccttgtgggcattcttcatcttcaaagagccctggtcctgagg
aggaaaagaaagcgaatgactgaccccaccaggagattcttcaaagtgacgcctccccca
ggaagcgggccccagaaccagtacgggaacgtgctgtctctccccacacccacctcaggc
ctcggacgcgcccagcgttgggccgcaggcctggggggcactgccccgtcttatggaaac
ccgagcagcgacgtccaggcggatggagccttggggtcccggagcccgccgggagtgggc
ccagaagaagaggaaggggagggctatgaggaacctgacagtgaggaggactccgagttc
tatgagaacgactccaaccttgggcaggaccagctctcccaggatggcagcggctacgag
aaccctgaggatgagcccctgggtcctgaggatgaagactccttctccaacgctgagtct
tatgagaacgaggatgaagagctgacccagccggtcgccaggacaatggacttcctgagc
cctcatgggtcagcctgggaccccagccgggaagcaacctccctggcagggtcccagtcc
tatgaggatatgagaggaatcctgtatgcagccccccagctccgctccattcggggccag
cctggacccaatcatgaggaagatgcagactcttatgagaacatggataatcccgatggg
ccagacccagcctggggaggagggggccgcatgggcacctggagcaccaggtga

DBGET integrated database retrieval system