KEGG   Homo sapiens (human): 93010Help
Entry
93010             CDS       T01001                                 

Gene name
B3GNT7, beta3GnT7
Definition
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
Orthology
K09664  
beta-1,3-N-acetylglucosaminyltransferase 7 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - keratan sulfate
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - keratan sulfate [PATH:hsa00533]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.1
AA seq 401 aa AA seqDB search
MSLWKKTVYRSLCLALALLVAVTVFQRSLTPGQFLQEPPPPTLEPQKAQKPNGQLVNPNN
FWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYF
PMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGRERQSAGGGRGAVRTLFLLGTA
SKQEERTHYQQLLAYEDRLYGDILQWGFLDTFFNLTLKEIHFLKWLDIYCPHVPFIFKGD
DDVFVNPTNLLEFLADRQPQENLFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGG
GGFLMAGSLARRLHHACDTLELYPIDDVFLGMCLEVLGVQPTAHEGFKTFGISRNRNSRM
NKEPCFFRAMLVVHKLLPPELLAMWGLVHSNLTCSRKLQVL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtggaagaaaaccgtctaccggagtctgtgcctggccctggccctgctcgtg
gccgtgacggtgttccaacgcagtctcacccctggtcagtttctgcaggagcctccgcca
cccaccctggagccacagaaggcccagaagccaaatggacagctggtgaaccccaacaac
ttctggaagaacccgaaagatgtggctgcgcccacgcccatggcctctcaggggccccag
gcctgggacgtgaccaccactaactgctcagccaatatcaacttgacccaccagccctgg
ttccaggtcctggagccgcagttccggcagtttctcttctaccgccactgccgctacttc
cccatgctgctgaaccacccggagaagtgcaggggcgatgtctacctgctggtggttgtc
aagtcggtcatcacgcagcacgaccgccgcgaggccatccgccagacctggggccgcgag
cggcagtccgcgggtgggggccgaggcgccgtgcgcaccctcttcctgctgggcacggcc
tccaagcaggaggagcgcacgcactaccagcagctgctggcctacgaagaccgcctctac
ggcgacatcctgcagtggggctttctcgacaccttcttcaacctgaccctcaaggagatc
cacttcctcaagtggctggacatctactgcccccacgtccccttcattttcaaaggcgac
gatgacgtcttcgtcaaccccaccaacctgctagaatttctggctgaccggcagccacag
gaaaacctgttcgtgggcgatgtcctgcagcacgctcggcccattcgcaggaaagacaac
aaatactacatcccgggggccctgtacggcaaggccagctatccgccgtatgcaggcggc
ggtggcttcctcatggccggcagcctggcccggcgcctgcaccatgcctgcgacaccctg
gagctctacccgatcgacgacgtctttctgggcatgtgcctggaggtgctgggcgtgcag
cccacggcccacgagggcttcaagactttcggcatctcccggaaccgcaacagccgcatg
aacaaggagccgtgctttttccgcgccatgctcgtggtgcacaagctgctgccccctgag
ctgctcgccatgtgggggctggtgcacagcaatctcacctgctcccgcaagctccaggtg
ctctga

DBGET integrated database retrieval system