KEGG   Homo sapiens (human): 9310Help
Entry
9310              CDS       T01001                                 

Gene name
ZNF235, ANF270, HZF6, ZFP93, ZNF270
Definition
zinc finger protein 235
Orthology
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 738 aa AA seqDB search
MTKFQEAVTFKDVAVAFTEEELGLLDSAQRKLYRDVMLENFRNLVSVGHQSFKPDMISQL
EREEKLWMKELQTQRGKHSGDRNQNEMATLHKAGLRCFSLGELSCWQIKRHIASKLARSQ
DSMINIEGKSSQFPKHHDSPCQVGAGESIQASVDDNCLVNHIGDHSSIIENQEFPTGKVP
NSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHHDDNIVHKRDKVHSNSD
CGKDTLKVSPLTQRSIHTGQKTYQGNECEEAFNDSSSLELHKQVHLGKKSPACSTHEKDT
SYSSGIPVQQSVRTGKKRYWCHECGKGFSQSSNLQTHQRVHTGEKPYTCHECGKSFNQSS
HLYAHLPIHTGEKPYRCDSCGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQA
HERIHTGEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCDECGKCFSLSFNLHSHQRV
HTGEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFRCNVCGKGFSQSSYFQAHQRVHTGE
KPYKCEVCGKRFNWSLNLHNHQRVHTGEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFK
CDACQKRFSQASHLQAHQRVHTGEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEEC
GKEFSWSAGLSAHQRVHTGEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDVCCKGF
SQRSHLIYHQRVHTGGNL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagttccaggaggcagtgacattcaaggatgtggctgtggccttcactgaggag
gagctggggctgctggactctgcccagaggaagctgtaccgagatgtgatgctggagaac
tttaggaacctggtttcagtgggacatcagtccttcaaaccagatatgatatcccagttg
gagagggaagaaaagctttggatgaaggagcttcaaacccaaagaggtaagcattcagga
gacaggaatcaaaatgagatggcaactcttcacaaagcaggattaaggtgcttttcactg
ggagagctttcatgctggcaaatcaagagacacattgcgagcaaattagccagaagtcaa
gactccatgataaatattgaaggaaagagctctcagttccccaagcaccatgattccccc
tgtcaagtgggagcaggagaatctattcaagcttctgtggatgacaactgtctagtgaat
cacataggggatcattccagtatcattgaaaatcaagaatttccaactgggaaagttccg
aattcttggagtaaaatatatctgaatgagacacagaattatcagagaagttgtaagcag
actcagatgaaaaacaaactatgtatatttgctccatatgttgacattttcagttgtatt
tcacaccaccatgatgataatatagtgcacaaaagagataaagttcatagcaatagtgat
tgtggtaaagataccctaaaggtatcacctcttacccagcgtagtattcacacaggacag
aaaacctaccagggtaatgaatgtgaagaagccttcaatgatagctccagtcttgaactt
cataaacaggtacacttgggaaagaagtctccagcgtgtagtacacatgagaaggacacc
agttatagctcaggtattcctgttcaacaaagtgttcgtactgggaaaaaacgctattgg
tgtcatgaatgtggtaaaggtttcagtcagagctcaaatctgcaaactcatcagagagtc
cacacaggggagaaaccctatacatgccacgagtgtggtaagagctttaatcagagctca
catctttatgctcatttgcctattcacacaggagagaagccctatagatgtgacagttgt
gggaagggcttcagtcgtagcacagatcttaacattcattgcagagttcacactggagag
aaaccttataaatgtgaggtgtgtgggaagggcttcactcagagatcacatcttcaggcc
catgaaagaattcacactggagagaaaccatataaatgtggggattgtggtaaacgcttt
agttgtagctcaaatcttcatacccatcagagagtccacactgaagaaaaaccatacaaa
tgtgatgagtgtggtaagtgctttagtttgagctttaatcttcatagtcatcaacgagtc
cacacaggagaaaaaccatataaatgtgaagagtgtggtaagggttttagttcagcctca
agtttccagagccatcagagggtccatacaggagagaaaccatttcgatgcaacgtgtgt
gggaaaggcttcagtcagagttcatactttcaagcacatcagagagtccacactggagaa
aaaccatacaaatgtgaagtgtgtgggaagcgcttcaattggagcttgaatcttcacaat
catcagagagtccacaccggagagaaaccctacaaatgtgaagagtgtggtaagggtttc
agtcaggcttcaaatcttcaagcccatcagagcgtccacactggggaaaaaccattcaag
tgtgatgcatgtcagaagcgattcagtcaggcctcacaccttcaagcccatcagagagtc
cacaccggagagaaaccatataaatgtgacacttgtggtaaggccttcagccagaggtca
aatcttcaagtccatcagataattcacactggagagaaaccatttaaatgtgaggaatgt
gggaaagaattcagttggagtgctggtctcagtgcccatcagagggtccacacaggagag
aaaccctatacgtgtcagcagtgtgggaagggcttcagtcaggcctcacattttcacaca
caccagagagtccacactggagagaggccttacatatgtgatgtctgttgtaagggcttc
agtcagaggtcacatctcatctaccatcagagagtccacactggagggaatctgtag

DBGET integrated database retrieval system