KEGG   Homo sapiens (human): 9315Help
Entry
9315              CDS       T01001                                 

Gene name
NREP, C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17
Definition
(RefSeq) neuronal regeneration related protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Alveol-reg_P311
Motif
Other DBs
NCBI-GeneID: 9315
NCBI-ProteinID: NP_001135948
OMIM: 607332
HGNC: 16834
Ensembl: ENSG00000134986
Vega: OTTHUMG00000128795
Pharos: Q16612(Tbio)
UniProt: Q16612
Position
5q22.1
AA seq 68 aa AA seqDB search
MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSP
RISYLHFF
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggtttattacccagaactctttgtctgggtcagtcaagaaccatttccaaacaaggac
atggagggaaggcttcctaagggaagacttcctgtcccaaaggaagtgaaccgcaagaag
aacgatgagacaaacgctgcctccctgactccactgggcagcagtgaactccgctcccca
agaatcagttacctccactttttttaa

DBGET integrated database retrieval system