KEGG   Homo sapiens (human): 9315Help
Entry
9315              CDS       T01001                                 

Gene name
NREP, C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17
Definition
(RefSeq) neuronal regeneration related protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16612(Tbio)
UniProt: 
Position
5q22.1
AA seq 68 aa AA seqDB search
MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSP
RISYLHFF
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggtttattacccagaactctttgtctgggtcagtcaagaaccatttccaaacaaggac
atggagggaaggcttcctaagggaagacttcctgtcccaaaggaagtgaaccgcaagaag
aacgatgagacaaacgctgcctccctgactccactgggcagcagtgaactccgctcccca
agaatcagttacctccactttttttaa

DBGET integrated database retrieval system