KEGG   Homo sapiens (human): 9320Help
Entry
9320              CDS       T01001                                 

Gene name
TRIP12, TRIP-12, ULF
Definition
(RefSeq) thyroid hormone receptor interactor 12
  KO
K10590  
E3 ubiquitin-protein ligase TRIP12 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9320 (TRIP12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     9320 (TRIP12)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   9320 (TRIP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q14669(Tbio)
UniProt: 
Position
2q36.3
AA seq 1992 aa AA seqDB search
MSNRPNNNPGGSLRRSQRNTAGAQPQDDSIGGRSCSSSSAVIVPQPEDPDRANTSERQKT
GQVPKKDNSRGVKRSASPDYNRTNSPSSAKKPKALQHTESPSETNKPHSKSKKRHLDQEQ
QLKSAQSPSTSKAHTRKSGATGGSRSQKRKRTESSCVKSGSGSESTGAEERSAKPTKLAS
KSATSAKAGCSTITDSSSAASTSSSSSAVASASSTVPPGARVKQGKDQNKARRSRSASSP
SPRRSSREKEQSKTGGSSKFDWAARFSPKVSLPKTKLSLPGSSKSETSKPGPSGLQAKLA
SLRKSTKKRSESPPAELPSLRRSTRQKTTGSCASTSRRGSGLGKRGAAEARRQEKMADPE
SNQEAVNSSAARTDEAPQGAAGAVGMTTSGESESDDSEMGRLQALLEARGLPPHLFGPLG
PRMSQLFHRTIGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKS
VVPALITLLQMEHNFDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAE
QALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFV
ADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTP
PILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRS
PQELYELTSLICELMPCLPKEGIFAVDTMLKKGNAQNTDGAIWQWRDDRGLWHPYNRIDS
RIIEQINEDTGTARAIQRKPNPLANSNTSGYSESKKDDARAQLMKEDPELAKSFIKTLFG
VLYEVYSSSAGPAVRHKCLRAILRIIYFADAELLKDVLKNHAVSSHIASMLSSQDLKIVV
GALQMAEILMQKLPDIFSVYFRREGVMHQVKHLAESESLLTSPPKACTNGSGSMGSTTSV
SSGTATAATHAAADLGSPSLQHSRDDSLDLSPQGRLSDVLKRKRLPKRGPRRPKYSPPRD
DDKVDNQAKSPTTTQSPKSSFLASLNPKTWGRLSTQSNSNNIEPARTAGGSGLARAASKD
TISNNREKIKGWIKEQAHKFVERYFSSENMDGSNPALNVLQRLCAATEQLNLQVDGGAEC
LVEIRSIVSESDVSSFEIQHSGFVKQLLLYLTSKSEKDAVSREIRLKRFLHVFFSSPLPG
EEPIGRVEPVGNAPLLALVHKMNNCLSQMEQFPVKVHDFPSGNGTGGSFSLNRGSQALKF
FNTHQLKCQLQRHPDCANVKQWKGGPVKIDPLALVQAIERYLVVRGYGRVREDDEDSDDD
GSDEEIDESLAAQFLNSGNVRHRLQFYIGEHLLPYNMTVYQAVRQFSIQAEDERESTDDE
SNPLGRAGIWTKTHTIWYKPVREDEESNKDCVGGKRGRAQTAPTKTSPRNAKKHDELWHD
GVCPSVSNPLEVYLIPTPPENITFEDPSLDVILLLRVLHAISRYWYYLYDNAMCKEIIPT
SEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDR
AMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVMQDLGSSRAMLEIQY
ENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNLQGLFALP
FGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFD
IDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFP
NIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPE
ELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTG
SPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLI
AAREGQQSFHLS
NT seq 5979 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccggcctaataacaatccaggggggtcactgcgacgttcacagaggaacact
gccggggcccaaccacaagacgactcaataggaggaagaagctgcagttcatcatctgct
gtgatagttccacaaccagaggatccagacagagccaatacttcagaaagacaaaaaacg
gggcaggtgcctaagaaagacaattctcgaggagtgaagcgcagtgctagtccagactac
aacaggaccaattctcctagctctgcaaaaaaaccaaaagcacttcagcatactgaatct
ccctcagaaacaaataagccacatagtaagtcaaagaagagacatttagaccaggagcaa
caactgaaatctgcacaatcaccatcaacaagcaaggctcataccaggaagagtggggcc
actggcggttcacggagtcagaaaagaaaaaggacagagagttcttgtgtaaagagtggc
tccgggtctgaatcaactggtgcagaagagagatctgcgaaacctaccaagctggcttca
aaatcagccacctcagccaaagctgggtgtagcaccatcactgattcttcttctgctgcc
tctacttcctcctcgtcttctgctgtagcctcggcctcctccactgtaccaccaggtgcc
agagtgaaacaaggaaaagatcagaacaaggccaggcgttcccgttcagcgtccagtccc
agccccagaagaagtagcagggaaaaggaacagagtaaaactggtggctcttcaaaattt
gattgggctgctcgtttcagccctaaagttagccttcctaaaacaaaactgtctcttcca
gggtcttctaagtcagagacatcaaaacctggaccttctggattacaggccaaattagca
agtttaagaaaatctacgaagaaacgcagtgagtctccacctgctgagctccccagtttg
aggcggagcacacgccaaaagaccacgggctcctgtgctagtaccagtcggcgaggctct
ggcctgggcaaaagaggagcagctgaagctcgtcgacaggagaaaatggcagaccctgaa
agcaaccaggaggcagtaaattcttcagctgctcggacagatgaagctccccaaggagct
gcaggggctgttggcatgaccacctctggggagagtgaatcagatgattccgagatggga
cgtttgcaagctttgttagaggcaaggggtcttccccctcacctatttggtcctcttggt
cctcggatgtcacagcttttccatagaacaattggaagtggagctagttctaaggcccag
cagctactacaaggattgcaagccagtgatgaaagtcaacagcttcaggcagttattgag
atgtgtcagttactggtcatgggaaatgaggagacactgggagggtttcctgtcaagagt
gttgttccagctttgattacgttacttcagatggagcacaattttgatattatgaaccat
gcttgtcgagccttaacatacatgatggaagcacttcctcgatcttctgctgttgtagta
gatgctattcctgtctttttagaaaagctgcaagttattcagtgtattgatgtggcagag
caggccttgactgccttggagatgttgtcacggagacatagtaaagccattctacaggcg
ggtggtttggcagactgcttgctgtacctagaattcttcagcataaatgcccaaagaaat
gcattagcaattgcagctaattgctgccagagtatcacgccagatgaatttcattttgtg
gcagattcactcccattgctaacccaaaggctaacacatcaggataaaaagtcagtagaa
agcacttgcctttgttttgcacgcctagtggacaacttccagcatgaggagaatttactc
cagcaggttgcttccaaagatctgcttacaaatgttcaacagctgttggtagtgactcca
cccattttaagttctgggatgtttataatggtggttcgcatgttttctctgatgtgttcc
aactgtccaactttagctgttcaacttatgaaacaaaacattgcagaaacgcttcacttt
ctcctgtgtggtgcctccaatggaagttgtcaggaacagattgatcttgttccacgaagc
cctcaagagttgtatgaactgacatctctgatttgtgaacttatgccatgtttaccaaaa
gaaggcatttttgcagttgataccatgttgaagaagggaaatgcacagaacacagatggt
gcgatatggcagtggcgtgatgatcggggcctctggcatccatataacaggattgacagc
cggatcattgagcaaatcaatgaggacacgggaacagcacgtgccattcagagaaaacct
aacccgttagccaatagtaacactagtggatattcagagtcaaagaaggatgatgctcga
gcacagcttatgaaagaggatccggaactggctaagtcttttattaagacattatttggt
gttctttatgaagtgtatagttcctcagcaggacctgcggtcagacataagtgccttaga
gcaattcttaggataatttattttgcggatgctgaacttctgaaggatgttctgaaaaat
catgctgtttcaagtcacattgcttccatgctgtcaagccaagacctgaagatagtagtg
ggagcacttcagatggcagaaattttaatgcagaagttacctgatatttttagtgtttac
ttcagaagagaaggtgtaatgcatcaagtaaaacacttagcagaatcagagtctttgttg
acaagtccaccaaaggcatgtacgaatggatcgggatccatgggatccacaacttcagtc
agcagtgggacagccacagctgccactcatgctgcagctgacttgggatcacccagcttg
cagcacagcagggatgattctttagatctcagccctcaaggtcgattaagtgatgttcta
aagagaaaacgactgccaaaacgagggccaagaaggccaaagtactcacctccaagagat
gatgacaaagtagacaatcaagctaaaagccccaccactactcagtcacctaaatcttct
ttcctggcaagcttgaatccaaaaacatggggaaggttaagtacacagtccaacagcaac
aacattgagccagcacggactgcgggaggtagtggccttgccagggctgcctcaaaggat
accatctccaataatagagaaaaaattaaaggttggattaaggagcaggcacataaattt
gtagaacgttatttcagttctgagaatatggatggaagcaaccctgcattgaatgtcctt
cagagactttgtgctgcaaccgaacaactcaacctccaggtggatggtggagctgagtgc
cttgtagaaatccgtagcatagtctcagagtcagatgtttcatcatttgaaatccaacat
agtggatttgtgaagcagctgttgctttatttgacatctaaaagtgaaaaggatgctgtg
agcagagagatcagattaaagcgatttcttcatgtatttttttcttctccacttcctgga
gaagagcccattggaagagtggaaccagtgggtaatgcacctttgttggcattagttcac
aagatgaacaactgcctcagccagatggaacaatttccagtcaaagtacatgatttccct
agtggaaatgggacaggaggcagcttttctctcaacagaggatcacaggctttaaaattt
ttcaacacacatcaattaaaatgccagttacaaaggcatccagactgtgcaaatgtgaag
cagtggaagggtggacctgtcaagattgaccctctggctttggtacaagccatcgagaga
taccttgtagttagagggtatggaagagtaagagaagatgatgaagacagcgatgacgat
ggatcagatgaggaaatagatgagtctctggctgctcagttcctaaattcaggaaatgta
agacacaggctgcagttttatattggagaacatttgctgccgtataacatgactgtgtat
caggcagtacggcagtttagtatacaggctgaagatgaaagagaatccacagatgatgag
agcaatcctctaggcagagctggtatttggacaaagactcatacaatatggtataaacct
gtgagagaggatgaagaaagtaataaagattgtgttggtggtaaaagaggaagagcccaa
acagctccaacgaaaacttcccctagaaatgcaaaaaagcatgatgagttatggcacgat
ggagtgtgcccatcagtatcaaatcctttagaagtttacctcattcccacaccacctgaa
aatataacatttgaagacccgtcattagatgtgatccttcttttaagagttttacatgct
atcagtcgatactggtattacttgtatgataatgcaatgtgcaaggaaattattccaact
agtgaatttattaacagtaagttaacagcaaaagcaaataggcaacttcaagatccttta
gtaatcatgacaggaaacatcccaacatggcttactgagctaggaaaaacctgcccattt
ttctttccttttgatacccggcaaatgcttttttatgtaactgcatttgatcgggaccga
gcaatgcaaagattacttgataccaacccagaaatcaaccagtctgattctcaagatagc
agagttgcacctagattggatagaaaaaaacgtactgtgaaccgagaggagctgctgaaa
caggcggagtctgtgatgcaggacctcggcagctcacgggccatgttagaaatccagtat
gaaaatgaggttggtacaggtcttgggcctacactggagttttatgcgcttgtatctcag
gaactacagagagctgacttgggtctttggagaggtgaagaagtaactcttagcaatcca
aaagggagccaagaagggaccaagtatattcaaaacctccagggcctgtttgcgcttccc
tttggtaggacagcaaagccagctcatatcgcaaaggttaagatgaagtttcgcttctta
ggaaaattaatggccaaggctatcatggatttcagattggtggaccttccccttggctta
cccttttataaatggatgctacggcaagaaacttcactgacatcacacgatttgtttgac
atcgacccagttgtagccagatcagtttatcacctagaagacattgtcagacagaagaaa
agacttgaacaagataaatcccagaccaaagagagtctacagtatgcattagaaaccttg
actatgaatggctgctcagttgaagatctaggactggatttcactctgccagggtttccc
aatatcgaactgaagaaaggagggaaggatataccagtcactatccacaatttagaggag
tatctaagactggttatattctgggcactaaatgaaggcgtttctaggcaatttgattcg
ttcagagatggatttgaatcagtcttcccactcagtcatcttcagtacttctacccggag
gaactggatcagctcctttgtggcagtaaagcagacacttgggatgcaaagacactgatg
gaatgctgtaggcctgatcatggttatactcatgacagtcgggctgtgaagtttttgttt
gagattctcagtagttttgataatgagcagcagaggttatttctccagtttgtgactggt
agcccaagattgcctgttggaggattccggagtttgaatccacctttgacaattgtccga
aagacgtttgaatcaacagaaaacccagatgacttcttgccctctgtaatgacttgtgtg
aactatcttaagttgccggactattcaagcattgagataatgcgtgaaaaactgttgata
gcagcaagagaagggcagcagtcgttccatctttcctga

DBGET integrated database retrieval system