KEGG   Homo sapiens (human): 9322Help
Entry
9322              CDS       T01001                                 

Gene name
TRIP10, CIP4, HSTP, STOT, STP, TRIP-10
Definition
thyroid hormone receptor interactor 10
Orthology
K07196  
thyroid hormone receptor interactor 10
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    9322 (TRIP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 601 aa AA seqDB search
MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAK
DDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEG
RRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRS
HMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELE
VVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSL
GTPSDGRPELRGPGRSRTKRWPFGKKNKPRPPPLSPLGGPVPSALPNGPPSPRSGRDPLA
ILSEISKSVKPRLASFRSLRGSRGTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQ
REALKKMKDVYEKTPQMGDPASLEPQIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRG
DSLSRHARPPDPPASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTS
PIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
N
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggattggggcactgagctgtgggatcagttcgaggtgctcgagcgccacacgcagtgg
gggctggacctgttggacagatatgtaaagttcgtgaaagaacgcaccgaagtggaacag
gcttacgccaaacaactgcggagcctggtgaaaaaatatctgcccaagagacctgccaag
gatgatcctgagtccaaattcagccagcaacagtccttcgtacagattctccaggaggtg
aatgactttgcaggccagcgggagctggtggctgagaacctcagtgtccgtgtatgtctt
gagctgaccaagtactcacaagagatgaaacaggagaggaagatgcacttccaagaaggg
cggcgggcccagcagcagctggaaaatggctttaaacagctggagaatagtaagcgtaaa
tttgagcgggactgccgggaggcagagaaggcagcccagactgctgaacggctagaccag
gatatcaacgccaccaaggctgatgtggagaaggccaagcagcaagcccaccttcggagt
cacatggccgaagaaagcaaaaacgaatatgcggctcaactgcagcgcttcaaccgagac
caagcccacttctatttttcacagatgccccagatattcgataagctccaagacatggat
gaacgcagggccacccgcctgggtgccgggtatgggctcctgtcggaggccgagctggag
gtggtgcccataatagccaagtgcttggagggcatgaaggtggctgcaaatgctgtggat
cccaagaacgactcccacgtccttatagagctgcacaagtcaggttttgcccgcccgggc
gacgtggaattcgaggacttcagccagcccatgaaccgtgcaccctccgacagcagtctg
ggcaccccctcggatggacggcctgaactccgaggcccgggtcgcagccgcaccaagcgc
tggccttttggcaagaagaacaagcctcgccccccacccctctcccccctggggggcccc
gtaccctcggcattgcctaacggacccccgtccccccgctccggccgtgaccccttggcc
atactgagcgagatcagtaagtcggtcaaaccgaggctagcatccttccgcagccttcga
ggcagccgtgggacagtggtgaccgaggattttagccacttgcccccagagcagcagcga
aaacggcttcaacagcagttggaagaacgcagtcgtgaacttcagaaggaggttgaccag
agggaagccctaaagaaaatgaaggatgtctatgagaagacacctcagatgggggacccc
gccagcttggagccccagatcgctgaaaccctgagcaacattgaacggctgaaattggaa
gtgcagaagtatgaggcgtggctggcagaagctgaaagtcgagtccttagcaaccgggga
gacagcctgagccggcacgcccggcctcccgacccccccgctagcgccccgccagacagc
agcagcaacagcgcatcacaggacaccaaggagagctctgaagagcctccctcagaagag
agccaggacacccccatttacacggagtttgatgaggatttcgaggaggaacccacatcc
cccataggtcactgtgtggccatctaccactttgaagggtccagcgagggcactatctct
atggccgagggtgaagacctcagtcttatggaagaagacaaaggggacggctggacccgg
gtcaggcggaaagagggaggcgagggctacgtgcccacctcctacctccgagtcacgctc
aattga

DBGET integrated database retrieval system