KEGG   Homo sapiens (human): 9329Help
Entry
9329              CDS       T01001                                 

Gene name
GTF3C4, KAT12, TFIII90, TFIIIC290, TFIIIC90, TFIIICDELTA
Definition
general transcription factor IIIC, polypeptide 4, 90kDa (EC:2.3.1.48)
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     9329 (GTF3C4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     9329 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q34.13
AA seq 822 aa AA seqDB search
MNTADQARVGPADDGPAPSGEEEGEGGGEAGGKEPAADAAPGPSAAFRLMVTRREPAVKL
QYAVSGLEPLAWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKV
GSKTEVAECKEKFAASKDPTVSQTFMLDRVFNPEGKALPPMRGFKYTSWSPMGCDANGRC
LLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRLSKNEAPEGNLGDFAEFQ
RRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESI
SSCNTIESGITSPSVLFWWEYEHNNRKMSGLIVGSAFGPIKILPVNLKAVKGYFTLRQPV
ILWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTG
LHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGI
AVSPCGAYLAIITTEGMINGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLI
DLVRWKILKDKHIPQFLQEALEKKIESSGVTYFWRFKLFLLRILYQSMQKTPSEALWKPT
HEDSKILLVDSPGMGNADDEQQEEGTSSKQVVKQGLQERSKEGDVEEPTDDSLPTTGDAG
GREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDE
EYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSC
QSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggccgaccaggcccgggtggggcccgcggacgacgggcctgcgccgtctggg
gaggaggagggagaggggggcggcgaggcgggcgggaaggagccagcagcggacgcggcc
ccggggcccagcgctgcattccgcctcatggtgactcggcgggagccggccgtgaagctg
cagtatgcggtgagcggcctggaaccgctggcttggtccgaggaccaccgcgtgtctgtg
tccacggcccgcagcatcgctgtgctggagctcatctgcgacgtgcacaacccgggccag
gacctggttatccaccgcacctcggtgcccgcaccgctcaacagctgtctcctcaaagtt
ggctcaaaaacagaagttgctgagtgcaaggagaaattcgccgcctccaaggaccccacg
gtcagtcagactttcatgttggatagggtgttcaaccctgaggggaaggctttaccacca
atgagaggattcaagtacaccagctggtctcccatgggttgcgatgctaatggcaggtgc
ctcttggcagcactgaccatggacaatcgcctgaccatccaggcaaatctcaacagactg
cagtgggtccagctggttgacctgactgagatctatggagaacgtctttatgagaccagt
tacaggctctctaaaaatgaggccccggaaggaaatctcggggattttgctgagtttcag
aggagacacagcatgcagaccccagtcagaatggagtggtcgggcatctgtaccacccag
caggtcaagcataacaacgaatgccgggacgttggcagtgtgctcctggctgtcctcttt
gaaaacggtaatatcgccgtgtggcagtttcagctgccgtttgtaggaaaagaatccatc
tcttcatgcaacacaattgagtcaggaatcacctctcccagtgtattgttttggtgggaa
tatgagcacaataatcgaaaaatgagtggccttattgtggggagtgcttttggacccata
aaaattcttcctgtcaatctcaaagcagtcaaaggctatttcactttaaggcagcctgtt
atcttgtggaaagaaatggaccagttacctgtgcacagtatcaaatgtgtgccactttat
catccttaccagaagtgtagttgcagcttagtagtggctgcaagaggctcttatgtattt
tggtgtcttcttctgatctccaaagcagggctgaatgttcacaattcccatgtcacaggc
cttcactcactgccaattgtctccatgactgcagacaaacagaatggaacagtctatact
tgctccagtgacggaaaggtgaggcagctgattcccattttcacagatgttgcattgaag
tttgaacaccagttgattaaactctcagatgtgtttggctcagtgaggactcacgggata
gcagtgagcccctgcggtgcatacctggccatcatcaccactgagggcatgatcaacggc
ctccaccctgttaacaaaaactaccaggtccaatttgttactctcaaaacctttgaagag
gcagctgctcagctcctggaatcttcagttcaaaacctttttaagcaggtagatttaata
gacctagtacgctggaagattttaaaagataaacatatccctcaatttttacaagaagct
ttggaaaaaaagattgaaagcagtggagtcacctatttttggcgttttaagcttttcctc
ctgaggattttatatcagtcaatgcagaaaaccccttcagaagccttgtggaaacccacc
catgaggactcaaaaatcttactagtggattcgcctgggatgggcaatgctgacgatgaa
cagcaggaagaaggcacttcttccaaacaggtggtgaagcaaggcctgcaggagaggagc
aaggaaggagatgtagaggagcccactgatgactcgctccccacgactggagatgctgga
ggccgtgagccaatggaagagaaactcctggaaatccaagggaaaatcgaagctgtggag
atgcacttgaccagggaacacatgaagcgagtcttaggagaagtgtatctgcacacctgg
atcacagaaaacactagcatccccacccgcggactctgtaactttttaatgtctgatgaa
gagtatgatgacagaactgcacgggtgctgattggacatatctcaaagaagatgaacaaa
cagactttccctgagcactgtagtttgtgtaaagagatcttgccattcacagatcgcaaa
caggcagtctgttccaatggccacatttggctccggtgcttcttaacctaccagtcctgc
cagagtttgatatatagaaggtgtttgctccatgacagcattgcccggcatccagctcca
gaagatcccgactggattaagaggttactgcaaagcccctgccctttctgtgattctcct
gtcttctaa

DBGET integrated database retrieval system