KEGG   Homo sapiens (human): 9332Help
Entry
9332              CDS       T01001                                 

Gene name
CD163, M130, MM130, SCARI1
Definition
(RefSeq) CD163 molecule
  KO
K06545  
CD163 antigen
Organism
hsa  Homo sapiens (human)
Brite
Cellular antigens [BR:hsa04090]
 Proteins
  9332 (CD163)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.3
AA seq 1156 aa AA seqDB search
MSKLRMVLLEDSGSADFRRHFVNLSPFTITVVLLLSACFVTSSLGGTDKELRLVDGENKC
SGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSC
RGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRW
GTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKH
QGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDA
AVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAIWQCKHHEWGKHYCNHNED
AGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL
KTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRL
VGGDIPCSGRVEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQI
WAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKT
LGAWGSLCNSHWDIEDAHVLCQQLKCGVALSTPGGARFGKGNGQIWRHMFHCTGTEQHMG
DCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGPTRPTIPEESAVACIESGQLR
LVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGEAINATGSAHFGEGTGP
IWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLE
VFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPD
TLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDL
DDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGH
KEDAAVNCTDISVQKTPQKATTGRSSRQSSFIAVGILGVVLLAIFVALFFLTKKRRQRQR
LAVSSRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGM
EKEAILSHTEKENGNL
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaactcagaatggtgctacttgaagactctggatctgctgacttcagaagacat
tttgtcaacttgagtcccttcaccattactgtggtcttacttctcagtgcctgttttgtc
accagttctcttggaggaacagacaaggagctgaggctagtggatggtgaaaacaagtgt
agcgggagagtggaagtgaaagtccaggaggagtggggaacggtgtgtaataatggctgg
agcatggaagcggtctctgtgatttgtaaccagctgggatgtccaactgctatcaaagcc
cctggatgggctaattccagtgcaggttctggacgcatttggatggatcatgtttcttgt
cgtgggaatgagtcagctctttgggattgcaaacatgatggatggggaaagcatagtaac
tgtactcaccaacaagatgctggagtgacctgctcagatggatccaatttggaaatgagg
ctgacgcgtggagggaatatgtgttctggaagaatagagatcaaattccaaggacggtgg
ggaacagtgtgtgatgataacttcaacatagatcatgcatctgtcatttgtagacaactt
gaatgtggaagtgctgtcagtttctctggttcatctaattttggagaaggctctggacca
atctggtttgatgatcttatatgcaacggaaatgagtcagctctctggaactgcaaacat
caaggatggggaaagcataactgtgatcatgctgaggatgctggagtgatttgctcaaag
ggagcagatctgagcctgagactggtagatggagtcactgaatgttcaggaagattagaa
gtgagattccaaggagaatgggggacaatatgtgatgacggctgggacagttacgatgct
gctgtggcatgcaagcaactgggatgtccaactgccgtcacagccattggtcgagttaac
gccagtaagggatttggacacatctggcttgacagcgtttcttgccagggacatgaacct
gctatctggcaatgtaaacaccatgaatggggaaagcattattgcaatcacaatgaagat
gctggcgtgacatgttctgatggatcagatctggagctaagacttagaggtggaggcagc
cgctgtgctgggacagttgaggtggagattcagagactgttagggaaggtgtgtgacaga
ggctggggactgaaagaagctgatgtggtttgcaggcagctgggatgtggatctgcactc
aaaacatcttatcaagtgtactccaaaatccaggcaacaaacacatggctgtttctaagt
agctgtaacggaaatgaaacttctctttgggactgcaagaactggcaatggggtggactt
acctgtgatcactatgaagaagccaaaattacctgctcagcccacagggaacccagactg
gttggaggggacattccctgttctggacgtgttgaagtgaagcatggtgacacgtggggc
tccatctgtgattcggacttctctctggaagctgccagcgttctatgcagggaattacag
tgtggcacagttgtctctatcctggggggagctcactttggagagggaaatggacagatc
tgggctgaagaattccagtgtgagggacatgagtcccatctttcactctgcccagtagca
ccccgcccagaaggaacttgtagccacagcagggatgttggagtagtctgctcaagatac
acagaaattcgcttggtgaatggcaagaccccgtgtgagggcagagtggagctcaaaacg
cttggtgcctggggatccctctgtaactctcactgggacatagaagatgcccatgttctt
tgccagcagcttaaatgtggagttgccctttctaccccaggaggagcacgttttggaaaa
ggaaatggtcagatctggaggcatatgtttcactgcactgggactgagcagcacatggga
gattgtcctgtaactgctctaggtgcttcattatgtccttcagagcaagtggcctctgta
atctgctcaggaaaccagtcccaaacactgtcctcgtgcaattcatcgtctttgggccca
acaaggcctaccattccagaagaaagtgctgtggcctgcatagagagtggtcaacttcgc
ctggtaaatggaggaggtcgctgtgctgggagagtagagatctatcatgagggctcctgg
ggcaccatctgtgatgacagctgggacctgagtgatgcccacgtggtttgcagacagctg
ggctgtggagaggccattaatgccactggttctgctcattttggggaaggaacagggccc
atctggctggatgagatgaaatgcaatggaaaagaatcccgcatttggcagtgccattca
cacggctgggggcagcaaaattgcaggcacaaggaggatgcgggagttatctgctcagaa
ttcatgtctctgagactgaccagtgaagccagcagagaggcctgtgcagggcgtctggaa
gttttttacaatggagcttggggcactgttggcaagagtagcatgtctgaaaccactgtg
ggtgtggtgtgcaggcagctgggctgtgcagacaaagggaaaatcaaccctgcatcttta
gacaaggccatgtccattcccatgtgggtggacaatgttcagtgtccaaaaggacctgac
acgctgtggcagtgcccatcatctccatgggagaagagactggccagcccctcggaggag
acctggatcacatgtgacaacaagataagacttcaggaaggacccacttcctgttctgga
cgtgtggagatctggcatggaggttcctgggggacagtgtgtgatgactcttgggacttg
gacgatgctcaggtggtgtgtcaacaacttggctgtggtccagctttgaaagcattcaaa
gaagcagagtttggtcaggggactggaccgatatggctcaatgaagtgaagtgcaaaggg
aatgagtcttccttgtgggattgtcctgccagacgctggggccatagtgagtgtgggcac
aaggaagacgctgcagtgaattgcacagatatttcagtgcagaaaaccccacaaaaagcc
acaacaggtcgctcatcccgtcagtcatcctttattgcagtcgggatccttggggttgtt
ctgttggccattttcgtcgcattattcttcttgactaaaaagcgaagacagagacagcgg
cttgcagtttcctcaagaggagagaacttagtccaccaaattcaataccgggagatgaat
tcttgcctgaatgcagatgatctggacctaatgaattcctcagaaaattcccatgagtca
gctgatttcagtgctgctgaactaatttctgtgtctaaatttcttcctatttctggaatg
gaaaaggaggccattctgagccacactgaaaaggaaaatgggaatttataa

DBGET integrated database retrieval system