KEGG   Homo sapiens (human): 9334Help
Entry
9334              CDS       T01001                                 

Gene name
B4GALT5, B4Gal-T5, BETA4-GALT-IV, beta4Gal-T5, beta4GalT-V, gt-V
Definition
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 (EC:2.4.1.38)
Orthology
K09905  
beta-1,4-galactosyltransferase 5 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:hsa00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.1-q13.2
AA seq 388 aa AA seqDB search
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTI
GAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPS
MKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVL
FRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPE
SDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGED
DDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLN
YFANITYDALYKNITVNLTPELAQVNEY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcccgccgggggctgctgcggctgccgcgccgctcgctgctcgccgcgctcttc
ttcttttctctctcgtcctcgctgctgtacttcgtctatgtggcgcccggcatagtgaac
acctacctcttcatgatgcaagcccaaggcattctgatccgggacaacgtgagaacaatc
ggtgctcaggtttatgagcaggtgcttcggagtgcttatgccaagaggaacagcagtgta
aatgactcagattatcctcttgacttgaaccacagtgaaaccttcctgcaaactacaaca
tttcttcctgaagacttcacctactttgcaaaccatacctgccctgaaagactcccttcc
atgaagggcccaatagacataaacatgagtgaaattggaatggattacattcatgaactc
ttctccaaagacccaaccatcaagctcggaggtcactggaagccttctgattgcatgcct
cggtggaaggtggcgatccttatccccttccggaaccgccacgagcacctcccagtcctg
ttcagacacctgcttcccatgctccagcgccagcgcttgcagtttgcattttatgtggtt
gaacaagttggtacccaaccctttaatcgagccatgcttttcaacgttggctttcaagag
gcaatgaaagacttggattgggactgtttgatttttcatgatgtagatcacataccggaa
agtgatcgcaactattatggatgtggacagatgccgaggcattttgcaaccaaattggat
aagtatatgtatctgcttccttataccgagttctttggcggagtgagtggcttaacagtg
gaacaatttcggaaaatcaatggctttcctaatgctttctggggttggggtggagaagat
gacgacctctggaacagagtacagaatgcaggctattctgtgagccggccagagggtgac
acaggaaagtacaagtccattcctcatcaccatcgaggagaagtccagtttcttggaagg
tatgctctgctgaggaagtcaaaagaacggcaagggctggatggcctcaacaacctgaac
tactttgcaaacatcacatacgacgccttgtataaaaacataactgtcaacctgacaccc
gagctggctcaggtgaacgagtactga

DBGET integrated database retrieval system