KEGG   Homo sapiens (human): 9340Help
Entry
9340              CDS       T01001                                 

Gene name
GLP2R
Definition
(RefSeq) glucagon like peptide 2 receptor
  KO
K04582  
glucagon-like peptide 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Teduglutide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9340 (GLP2R)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Pancreatic peptide
   Glucagon
    9340 (GLP2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95838(Tclin)
UniProt: 
Position
17p13.1
AA seq 553 aa AA seqDB search
MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVS
IKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPS
YLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQL
MYTVGYSFSLISLFLALTLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYS
KRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLW
PRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLK
ILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI
QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKK
LSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTM
ANTMEEILEESEI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgggatcgagcagggcagggcctgggagaggaagcgcgggactcctgcctggc
gtccacgagctgcccatgggcatccctgccccctgggggaccagtcctctctccttccac
aggaagtgctctctctgggcccctgggaggcccttcctcactctggtcctgctggtttcc
atcaagcaagttacaggatccctccttgaggaaacgactcggaagtgggctcagtacaaa
caggcatgtctgagagacttactcaaggaaccttctggcatattttgtaacgggacattt
gatcagtacgtgtgttggcctcattcttctcctggaaatgtctctgtaccctgcccttca
tacttaccttggtggagtgaagagagctcaggaagggcctacagacactgcttggctcag
gggacttggcagacgatagagaacgccacggatatttggcaggatgactccgaatgctcc
gagaaccacagcttcaagcaaaacgtggatcgttatgccttgctgtcaaccttgcagctg
atgtacaccgtgggatactccttctctcttatctccctcttcctggctctcaccctcctc
ttgtttcttcgaaaactccactgcacgcgcaactacatccacatgaacttgtttgcttct
ttcatcctgagaaccctggctgtactggtgaaggacgtcgtcttctacaactcttactcc
aagaggcctgacaatgagaatgggtggatgtcctacctgtcagagatgtccacctcctgc
cgctcagtccaggttctcttgcattactttgtgggtgccaattacttatggctgctggtt
gaaggcctctacctccacacgctgctggagcccacagtgcttcctgagaggcggctgtgg
cccagatacctgctgttgggttgggccttccctgtgctatttgttgtaccctggggtttc
gcccgtgcacacctggagaacacagggtgctggacaacaaatgggaataagaaaatctgg
tggatcatccgaggacccatgatgctctgtgtaacagtcaatttcttcatcttcctgaaa
attctcaagcttctcatttctaagctcaaagctcatcaaatgtgcttcagagattataaa
tacagattggcaaaatcaacactggtcctcattcctttattgggcgttcatgagatcctc
ttctctttcatcactgatgatcaagttgaaggatttgcaaaacttatacgacttttcatt
cagttgacactgagctcctttcatgggttcctggtggccttgcagtatggttttgccaat
ggagaggtgaaggctgagctgcggaaatactgggtccgcttcttgctagcccgccactca
ggctgcagagcctgtgtcctggggaaggacttccggttcctaggaaaatgtcccaagaag
ctctcggaaggagatggcgctgagaagcttcggaagctgcagccctcacttaacagtggg
cggctcctacatctagccatgcgaggtcttggggagctgggcgcccagccccaacaggac
catgcacgctggccccggggcagcagcctgtccgagtgcagtgagggggatgtcaccatg
gccaacaccatggaggagattctggaagagagtgagatctag

DBGET integrated database retrieval system