KEGG   Homo sapiens (human): 93408Help
Entry
93408             CDS       T01001                                 

Gene name
MYL10, MYLC2PL, PLRLC
Definition
(RefSeq) myosin light chain 10
  KO
K12756  
myosin regulatory light chain 10
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    93408 (MYL10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    93408 (MYL10)
   04530 Tight junction
    93408 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    93408 (MYL10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     93408 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 226 aa AA seqDB search
MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA
LSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN
VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK
EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttaggctggtctcaaactcctggcctcaagtgatcctccctcctcggcctccc
aaagtgctgggattacaggcaccgagaagagctcggaaaagagcagaaggcaccgccagc
tccaacgtcttctccatgtttgatcagtcccagatccaggagtttaaagagagtctggct
ctgtcgcccaggctggagcgcaatggcatgatctcggctcactgcaacctctgcctcacg
ggttcaagcaattctcctgcctcagcctcccaagctttcaccatcatggaccagaaccgt
gatggcttcatcgacaaagaggacttgagggacacctttgccgcgctgggccgcatcaat
gtcaagaacgaggaactggaggccatggtgaaggaggcccccggacccatcaacttcacg
gtgttcctgaccatgtttggggagaagctgaagggcacggacccagaggagaccattctc
cacgccttcaaagtgttcgacactgaagggaaaggtttcgtcaaggccgatgtcatcaaa
gaaaaacttatgacccaggcagaccgcttcagtgaggaggaggtcaagcagatgtttgca
gcatttcccccagatgtgtgcggcaacctggactacagaaacctgtgctacgtcatcact
cacggtgaagagaaggattag

DBGET integrated database retrieval system