KEGG   Homo sapiens (human): 9341Help
Entry
9341              CDS       T01001                                 

Gene name
VAMP3, CEB
Definition
vesicle-associated membrane protein 3
Orthology
K13505  
vesicle-associated membrane protein 3
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Phagosome
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.23
AA seq 100 aa AA seqDB search
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQF
ETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaggtccaactgctgccactggcagtaatcgaagacttcagcagacacaaaat
caagtagatgaggtggtggacataatgcgagttaacgtggacaaggttctggaaagagac
cagaagctctctgagttagacgaccgtgcagacgcactgcaggcaggcgcttctcaattt
gaaacgagcgcagccaagttgaagaggaaatattggtggaagaattgcaagatgtgggca
atcgggattactgttctggttatcttcatcatcatcatcatcgtgtgggttgtctcttca
tga

DBGET integrated database retrieval system