KEGG   Homo sapiens (human): 9341Help
Entry
9341              CDS       T01001                                 

Gene name
VAMP3, CEB
Definition
vesicle-associated membrane protein 3
Orthology
K13505  
vesicle-associated membrane protein 3
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9341 (VAMP3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    9341 (VAMP3)
SNAREs [BR:hsa04131]
 VAMP, Ykt6, Sec22 (R)
  VAMP
   9341 (VAMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.23
AA seq 100 aa AA seqDB search
MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQF
ETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaggtccaactgctgccactggcagtaatcgaagacttcagcagacacaaaat
caagtagatgaggtggtggacataatgcgagttaacgtggacaaggttctggaaagagac
cagaagctctctgagttagacgaccgtgcagacgcactgcaggcaggcgcttctcaattt
gaaacgagcgcagccaagttgaagaggaaatattggtggaagaattgcaagatgtgggca
atcgggattactgttctggttatcttcatcatcatcatcatcgtgtgggttgtctcttca
tga

DBGET integrated database retrieval system