KEGG   Homo sapiens (human): 9342Help
Entry
9342              CDS       T01001                                 

Gene name
SNAP29, CEDNIK, SNAP-29
Definition
synaptosomal-associated protein, 29kDa
Orthology
K08509  
synaptosomal-associated protein, 29kDa
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Disease
H00799  
Cerebral dysgenesis, neuropathy, ichthyosis, and palmoplantar keratoderma syndrome
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 258 aa AA seqDB search
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAAST
SRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLV
NYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGA
GSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTK
VDKLDVNIKSTERKVRQL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttaccctaaaagctacaatccgttcgacgacgacggggaggacgaaggcgcc
cggccggccccttggagggacgcccgagacctccccgacgggcccgacgcgcccgcggac
aggcagcagtacttgcggcaggaggtcctccgcagggctgaggccacggccgccagcacc
agcaggtccctggccctcatgtacgagtccgagaaggttggggtcgcctcttccgaggag
ctcgcccgtcagcgaggagtcctggagcgcacagagaagatggtggacaagatggaccaa
gatttgaagatcagccagaaacacatcaatagcattaagagcgtgtttggggggctggtc
aattacttcaaatccaaaccagtagagaccccacctgaacagaatggcaccctcacctcc
cagcccaacaacagattgaaagaagctataagtacaagtaaagaacaggaagcaaagtac
caggccagccacccaaaccttagaaagctggatgatacagaccctgtccccagaggggct
ggttctgccatgagtactgatgcttacccaaagaacccacaccttcgagcctatcaccag
aagatcgacagcaacctagatgagctgtccatgggactgggtcgtctgaaggacatagcc
ctggggatgcagacagaaattgaggagcaagatgacattcttgaccggctgacaaccaaa
gtggacaagttagatgtcaacataaaaagcacagaaagaaaagttcgacaactctga

DBGET integrated database retrieval system