KEGG   Homo sapiens (human): 9342Help
Entry
9342              CDS       T01001                                 

Gene name
SNAP29, CEDNIK, SNAP-29
Definition
(RefSeq) synaptosome associated protein 29
  KO
K08509  
synaptosomal-associated protein 29
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Disease
H00799  
Cerebral dysgenesis, neuropathy, ichthyosis, and palmoplantar keratoderma syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    9342 (SNAP29)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    9342 (SNAP29)
 SNARE
  SNAP-25 (Qb,c)
   SNAP-29
    9342 (SNAP29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.21
AA seq 258 aa AA seqDB search
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAAST
SRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLV
NYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGA
GSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTK
VDKLDVNIKSTERKVRQL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttaccctaaaagctacaatccgttcgacgacgacggggaggacgaaggcgcc
cggccggccccttggagggacgcccgagacctccccgacgggcccgacgcgcccgcggac
aggcagcagtacttgcggcaggaggtcctccgcagggctgaggccacggccgccagcacc
agcaggtccctggccctcatgtacgagtccgagaaggttggggtcgcctcttccgaggag
ctcgcccgtcagcgaggagtcctggagcgcacagagaagatggtggacaagatggaccaa
gatttgaagatcagccagaaacacatcaatagcattaagagcgtgtttggggggctggtc
aattacttcaaatccaaaccagtagagaccccacctgaacagaatggcaccctcacctcc
cagcccaacaacagattgaaagaagctataagtacaagtaaagaacaggaagcaaagtac
caggccagccacccaaaccttagaaagctggatgatacagaccctgtccccagaggggct
ggttctgccatgagtactgatgcttacccaaagaacccacaccttcgagcctatcaccag
aagatcgacagcaacctagatgagctgtccatgggactgggtcgtctgaaggacatagcc
ctggggatgcagacagaaattgaggagcaagatgacattcttgaccggctgacaaccaaa
gtggacaagttagatgtcaacataaaaagcacagaaagaaaagttcgacaactctga

DBGET integrated database retrieval system