KEGG   Homo sapiens (human): 9344Help
Entry
9344              CDS       T01001                                 

Gene name
TAOK2, MAP3K17, PSK, PSK1, PSK1-BETA, TAO1, TAO2
Definition
TAO kinase 2 (EC:2.7.11.1)
Orthology
K04429  
thousand and one amino acid protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 1122 aa AA seqDB search
MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMS
YSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPVLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDA
VRELDNLQYRKMKKILFQEAPNGPGAEAPEEEEEAEPYMHRAGTLTSLESSHSVPSMSIS
ASSQSSSVNSLADASDNEEEEEEEEEEEEEEEGPEAREMAMMQEGEHTVTSHSSIIHRLP
GSDNLYDDPYQPEITPSPLQPPAAPAPTSTTSSARRRAYCRNRDHFATIRTASLVSRQIQ
EHEQDSALREQLSGYKRMRRQHQKQLLALESRLRGEREEHSARLQRELEAQRAGFGAEAE
KLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKEELQE
NPSTPKREKAEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQD
LLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEY
NKRREQELRQKHAAQVRQQPKSLKERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGP
ALTPVPEEEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLA
GLSFAVGSSSGLLPLLLLLLLPLLAAQGGGGLQAALLALEVGLVGLGASYLLLCTALHLP
SSLFLLLAQGTALGAVLGLSWRRGLMGVPLGLGAAWLLAWPGLALPLVAMAAGGRWVRQQ
GPRVRRGISRLWLRVLLRLSPMAFRALQGCGAVGDRGLFALYPKTNKDGFRSRLPVPGPR
RRNPRTTQHPLALLARVWVLCKGWNWRLARASQGLASHLPPWAIHTLASWGLLRGERPTR
IPRLLPRSQRQLGPPASRQPLPGTLAGRRSRTRQSRALPPWR
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgggggccgggccgggagcctgaaggacccagatgtggctgagctcttcttc
aaggatgacccagaaaagctcttctctgacctccgggaaattggccatggcagctttgga
gccgtatactttgcccgggatgtccggaatagtgaggtggtggccatcaagaagatgtcc
tacagtgggaagcagtccaatgagaaatggcaagacatcatcaaggaggtgcggttctta
cagaagctccggcatcccaacaccattcagtaccggggctgttacctgagggagcacacg
gcttggctggtaatggagtattgcctgggctcagcttctgaccttctagaagtgcacaag
aaaccccttcaggaggtagagatcgcagctgtgacccacggggcgcttcagggcctggca
tatctgcactcccacaacatgatccatagggatgtgaaggctggaaacatcctgctgtca
gagccagggttagtgaagctaggggactttggttctgcgtccatcatggcacctgccaac
tccttcgtgggcaccccatactggatggcacccgaggtgatcctggccatggatgagggg
cagtacgatggcaaagtggacgtctggtccttggggataacctgcatcgagctggctgaa
cggaaaccaccgctctttaacatgaatgcgatgagtgccttataccacattgcacagaac
gaatcccccgtgctccagtcaggacactggtctgagtacttccggaattttgtcgactcc
tgtcttcagaaaatccctcaagacagaccaacctcagaggttctcctgaagcaccgcttt
gtgctccgggagcggccacccacagtcatcatggacctgatccagaggaccaaggatgcc
gtgcgggagctggacaacctgcagtaccgcaagatgaagaagatcctgttccaagaggca
cccaacggccctggtgccgaggccccagaggaggaagaggaggccgagccctacatgcac
cgggccgggactctgaccagcctcgagagtagccactcagtgcccagcatgtccatcagc
gcctccagccagagcagctccgtcaacagcctagcagatgcctcagacaacgaggaagag
gaggaggaggaggaggaagaggaggaggaggaagaaggccctgaagcccgggagatggcc
atgatgcaggagggggagcacacagtcacctctcacagctccattatccaccggctgccg
ggctctgacaacctatatgatgacccctaccagccagagataacccccagccctctccag
ccgcctgcagccccagctcccacttccaccacctcttccgcccgccgccgggcctactgc
cgtaaccgagaccactttgccaccatccgaaccgcctccctggtcagccgtcagatccag
gagcatgagcaggactctgcgctgcgggagcagctgagcggctataagcggatgcgacga
cagcaccagaagcagctgctggccctggagtcacggctgaggggtgaacgggaggagcac
agtgcacggctgcagcgggagcttgaggcgcagcgggctggctttggggcagaggcagaa
aagctggcccggcggcaccaggccataggtgagaaggaggcacgagctgcccaggccgag
gagcggaagttccagcagcacatccttgggcagcagaagaaggagctggctgccctgctg
gaggcacagaagcggacctacaaacttcgcaaggaacagctgaaggaggagctccaggag
aaccccagcactcccaagcgggagaaggccgagtggctgctgcggcagaaggagcagctc
cagcagtgccaggcggaggaggaagcagggctgctgcggcggcagcgccagtactttgag
ctgcagtgtcgccagtacaagcgcaagatgttgctggctcggcacagcctggaccaggac
ctgctgcgggaggacctgaacaagaagcagacccagaaggacttggagtgtgcactgctg
cttcggcagcacgaggccacgcgggagctggagctgcggcagctccaggccgtgcagcgc
acgcgggctgagctcacccgcctgcagcaccagacggagctgggcaaccagctggagtac
aacaagcggcgtgagcaagagttgcggcagaagcatgcggcccaggttcgccagcagccc
aagagcctcaaagagaggagcattgttggccaggaggaggctgggacatggagcttgtgg
gggaaggaggatgagagtcttctggatgaggagtttgagcttggctgggtccagggccca
gcactgactcccgtccctgaggaggaggaagaagaggaagagggggctccgattgggacc
cctagggatcctggagatggttgtccttcccccgacatccctcctgaaccccctccaaca
cacctgaggccctgccctgccagccagctccctggactcctgtcccatggcctcctggcc
ggcctctcctttgcagtggggtcctcctctggcctcctgcccctcctgctgctgctgctg
cttccattgctggcagcccagggtgggggtggcctgcaggcagcgctgctggcccttgag
gtggggctggtgggtctgggggcctcctacctgctcctttgtacagccctgcacctgccc
tccagtcttttcctactcctggcccagggtaccgcactgggggccgtcctgggcctgagc
tggcgccgaggcctcatgggtgttcccctgggccttggagctgcctggctcttagcttgg
ccaggcctagctctacctctggtggctatggcagcggggggcagatgggtgcggcagcag
ggcccccgggtgcgccggggcatatctcgactctggttgcgggttctgctgcgcctgtca
cccatggccttccgggccctgcagggctgtggggctgtgggggaccggggtctgtttgca
ctgtaccccaaaaccaacaaggatggcttccgcagccgcctgcccgtccctgggccccgg
cggcgtaatccccgcaccacccaacacccattagctctgttggcaagggtctgggtcctg
tgcaagggctggaactggcgtctggcacgggccagccagggtttagcatcccacttgccc
ccgtgggccatccacacactggccagctggggcctgcttcggggtgaacggcccacccga
atcccccggctactaccacgcagccagcgccagctagggccccctgcctcccgccagcca
ctgccagggactctagccgggcggaggtcacgcacccgccagtcccgggccctgcccccc
tggaggtag

DBGET integrated database retrieval system