KEGG   Homo sapiens (human): 9350Help
Entry
9350              CDS       T01001                                 

Gene name
CER1, DAND4
Definition
(RefSeq) cerberus 1, DAN family BMP antagonist
  KO
K01645  cerberus 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    9350 (CER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAN Cys_knot Sclerostin ET
Motif
Other DBs
NCBI-GeneID: 9350
NCBI-ProteinID: NP_005445
OMIM: 603777
HGNC: 1862
Ensembl: ENSG00000147869
Vega: OTTHUMG00000021022
Pharos: O95813(Tbio)
UniProt: O95813
Position
9p22.3
AA seq 267 aa AA seqDB search
MHLLLFQLLVLLPLGKTTRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAV
PHLVATSPAGEGQRQREKMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMK
MEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVV
VQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQ
CKVKTEHEDGHILHAGSQDSFIPGVSA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcctcttatttcagctgctggtactcctgcctctaggaaagaccacacggcac
caggatggccgccagaatcagagttctctttcccccgtactcctgccaaggaatcaaaga
gagcttcccacaggcaaccatgaggaagctgaggagaagccagatctgtttgtcgcagtg
ccacaccttgtagccaccagccctgcaggggaaggccagaggcagagagagaagatgctg
tccagatttggcaggttctggaagaagcctgagagagaaatgcatccatccagggactca
gatagtgagcccttcccacctgggacccagtccctcatccagccgatagatggaatgaaa
atggagaaatctcctcttcgggaagaagccaagaaattctggcaccacttcatgttcaga
aaaactccggcttctcagggggtcatcttgcccatcaaaagccatgaagtacattgggag
acctgcaggacagtgcccttcagccagactataacccacgaaggctgtgaaaaagtagtt
gttcagaacaacctttgctttgggaaatgcgggtctgttcattttcctggagccgcgcag
cactcccatacctcctgctctcactgtttgcctgccaagttcaccacgatgcacttgcca
ctgaactgcactgaactttcctccgtgatcaaggtggtgatgctggtggaggagtgccag
tgcaaggtgaagacggagcatgaagatggacacatcctacatgctggctcccaggattcc
tttatcccaggagtttcagcttga

DBGET integrated database retrieval system