KEGG   Homo sapiens (human): 9350Help
Entry
9350              CDS       T01001                                 

Gene name
CER1, DAND4
Definition
cerberus 1, DAN family BMP antagonist
Orthology
K01645  
cerberus 1
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    9350 (CER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p23-p22
AA seq 267 aa AA seqDB search
MHLLLFQLLVLLPLGKTTRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAV
PHLVATSPAGEGQRQREKMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMK
MEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVV
VQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTELSSVIKVVMLVEECQ
CKVKTEHEDGHILHAGSQDSFIPGVSA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcctcttatttcagctgctggtactcctgcctctaggaaagaccacacggcac
caggatggccgccagaatcagagttctctttcccccgtactcctgccaaggaatcaaaga
gagcttcccacaggcaaccatgaggaagctgaggagaagccagatctgtttgtcgcagtg
ccacaccttgtagccaccagccctgcaggggaaggccagaggcagagagagaagatgctg
tccagatttggcaggttctggaagaagcctgagagagaaatgcatccatccagggactca
gatagtgagcccttcccacctgggacccagtccctcatccagccgatagatggaatgaaa
atggagaaatctcctcttcgggaagaagccaagaaattctggcaccacttcatgttcaga
aaaactccggcttctcagggggtcatcttgcccatcaaaagccatgaagtacattgggag
acctgcaggacagtgcccttcagccagactataacccacgaaggctgtgaaaaagtagtt
gttcagaacaacctttgctttgggaaatgcgggtctgttcattttcctggagccgcgcag
cactcccatacctcctgctctcactgtttgcctgccaagttcaccacgatgcacttgcca
ctgaactgcactgaactttcctccgtgatcaaggtggtgatgctggtggaggagtgccag
tgcaaggtgaagacggagcatgaagatggacacatcctacatgctggctcccaggattcc
tttatcccaggagtttcagcttga

DBGET integrated database retrieval system