KEGG   Homo sapiens (human): 9351Help
Entry
9351              CDS       T01001                                 

Gene name
SLC9A3R2, E3KARP, NHE3RF2, NHERF-2, NHERF2, OCTS2, SIP-1, SIP1, TKA-1
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
hsa  Homo sapiens (human)
Pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    9351 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 337 aa AA seqDB search
MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWE
PKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVD
PGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLR
VTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGL
HLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgccggagccgctgcggccgcgcctgtgccgcttggtgcgcggagagcagggc
tacggcttccacctgcacggcgagaagggccgccgcgggcagttcatccggcgcgtggaa
cccggttcccccgccgaggccgccgcgctgcgcgctggggaccgcctggtcgaggtcaac
ggcgtcaacgtggagggcgagacgcaccaccaggtggtgcaaaggatcaaggctgtggag
gggcagactcggctgctggtggtggaccaggagacagatgaggagctccgccggcggcag
ctgacctgtaccgaggagatggcccagcgagggctcccacccgcccacgacccctgggag
ccgaagccagactgggcacacaccggcagccacagctccgaagctggcaagaaggatgtc
agtgggcccctgagggagctgcgccctcggctctgccacctgcgaaagggacctcagggc
tatgggttcaacctgcatagtgacaagtcccggcccggccagtacatccgctctgtggac
ccgggctcacctgccgcccgctctggcctccgcgcccaggaccggctcattgaggtgaac
gggcagaatgtggagggactgcgccatgctgaggtggtggccagcatcaaggcacgggag
gacgaggcccggctgctggtcgtggaccccgagacagatgaacacttcaagcggcttcgg
gtcacacccaccgaggagcacgtggaaggtcctctgccgtcacccgtcaccaatggaacc
agccctgcccagctcaatggtggctctgcgtgctcgtcccgaagtgacctgcctggttcc
gacaaggacactgaggatggcagtgcctggaagcaagatcccttccaggagagcggcctc
cacctgagccccacggcggccgaggccaaggagaaggctcgagccatgcgagtcaacaag
cgcgcgccacagatggactggaacaggaagcgtgaaatcttcagcaacttctga

DBGET integrated database retrieval system