KEGG   Homo sapiens (human): 9354Help
Entry
9354              CDS       T01001                                 

Gene name
UBE4A, E4, UBOX2, UFD2
Definition
ubiquitination factor E4A
Orthology
K10596  
ubiquitin conjugation factor E4 A [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 1066 aa AA seqDB search
MTDQENNNNISSNPFAALFGSLADAKQFAAIQKEQLKQQSDELPASPDDSDNSVSESLDE
FDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDNSDPSLKSGNGIPSRCVYLEEMA
VELEDQDWLDMSNVEQALFARLLLQDPGNHLINMTSSTTLNLSADRDAGERHIFCYLYSC
FQRAKEEITKVPENLLPFAVQCRNLTVSNTRTVLLTPEIYVDQNIHEQLVDLMLEAIQGA
HFEDVTEFLEEVIEALILDEEVRTFPEVMIPVFDILLGRIKDLELCQILLYAYLDILLYF
TRQKDMAKVFVEYIQPKDPTNGQMYQKTLLGVILSISCLLKTPGVVENHGYFLNPSRSSP
QEIKVQEANIHQFMAQFHEKIYQMLKNLLQLSPETKHCILSWLGNCLHANAGRTKIWANQ
MPEIFFQMYASDAFFLNLGAALLKLCQPFCKPRSSRLLTFNPTYCALKELNDEERKIKNV
HMRGLDKETCLIPAVQEPKFPQNYNLVTENLALTEYTLYLGFHRLHDQMVKINQNLHRLQ
VAWRDAQQSSSPAADNLREQFERLMTIYLSTKTAMTEPQMLQNCLNLQVSMAVLLVQLAI
GNEGSQPIELTFPLPDGYSSLAYVPEFFADNLGDFLIFLRRFADDILETSADSLEHVLHF
ITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSVFHRKRVFCNFQYAPQLAE
ALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYRESIKDLADYASKNLEAMN
PPLFLRFLNLLMNDAIFLLDEAIQYLSKIKIQQIEKDRGEWDSLTPEARREKEAGLQMFG
QLARFHNIMSNETIGTLAFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGALKVKD
FSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNM
IMAFSNLAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIA
RHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccaggagaataacaacaacatctcaagtaacccctttgctgctctttttggc
tccctggctgatgccaaacagtttgcggcaatccaaaaagagcagctgaagcaacaatct
gatgaactcccagctagcccagatgactcggataatagcgtgtcagagagcctggatgaa
ttcgattactctgtggctgagattagccgctcattccgatcacagcaggaaatatgtgag
caactcaacatcaatcacatgatccaaaggatcttccttattactctggacaacagtgat
cccagcttgaaaagcgggaatggcatccctagccgttgtgtgtatttggaagaaatggca
gtagagctagaagatcaagactggcttgatatgagcaatgttgagcaggccctcttcgct
cgcttattacttcaagatccaggcaaccacttaattaacatgacttcttctacaacgcta
aatctctctgctgatcgagatgcaggagagaggcacattttttgttacctttactcctgc
ttccagagagccaaggaagagattaccaaagttccagagaacctgctaccctttgcagtg
cagtgcagaaacctcactgtgtccaatacccgaacagttcttctcaccccagagatctat
gttgaccaaaacatccatgagcaactggtagatttgatgttagaagccatccagggagcc
cattttgaagatgtaactgagtttctggaagaggtcattgaagccttgatattggatgag
gaagttagaacatttccagaagtcatgattccagtgtttgatattttattgggccgaata
aaagatctagagctctgtcagatccttttgtatgcatatctggatattcttctctatttc
actaggcaaaaagatatggcaaaggtttttgtagaatacattcagcccaaggaccctacc
aatgggcaaatgtaccagaagaccttgctgggagtaattctgagtatctcctgcttatta
aagactccgggtgttgtagaaaatcatggctactttttgaatccatctcgttccagcccc
caggagatcaaagtacaggaggccaacatccatcagttcatggctcagttccacgaaaag
atctaccagatgctgaagaacttactccagctctctccagaaaccaaacactgtatcttg
tcctggcttggaaactgtttgcatgcaaatgcaggccgcaccaagatttgggccaatcag
atgccagaaatctttttccaaatgtatgcctcagatgctttctttctgaatctgggtgct
gctctcctgaagctatgccagccattttgcaaacccagatcctctcggctcctcaccttt
aatcccacatactgtgccctcaaggagttgaatgatgaagaacgaaaaattaaaaatgta
cacatgagaggtttggacaaagaaacctgtttgatcccagctgtgcaggagccgaagttt
ccacagaactacaaccttgtaacagagaaccttgctctgacagagtacaccttgtacttg
ggatttcacaggttgcatgatcagatggtaaaaatcaaccaaaatctgcatcggctgcag
gttgcctggcgggatgctcagcaaagttctagccctgctgctgacaatcttcgtgagcag
tttgaacgactgatgaccatctatctttctaccaagactgccatgacagagccacaaatg
ctacaaaactgcctaaacttgcaggtgtccatggctgttctactggttcaactggccata
ggcaatgagggctcacagccaatagagctaacctttcctttgccagatggctacagctct
ttggcttatgtgccagaattttttgcagataacctgggtgattttctcatttttctccgc
cgctttgccgatgacattttggagacatcagcagattccctggagcatgtccttcacttt
atcaccattttcactggaagcatagaaagaatgaagaatccccacctgagggccaaacta
gcagaggtgttggaagcagtgatgccccacctggatcagaccccaaatcccttggtatcc
agtgtgttccaccggaaacgtgtgttctgcaactttcagtatgcaccccaacttgcagag
gctctaatcaaggtttttgtggacatcgaatttacaggagacccccatcaatttgaacag
aagtttaattaccgccgtcccatgtatcctatcctaagatacatgtgggggacagatacc
tatcgggagagcattaaggatttggctgactatgcctctaagaatttagaagccatgaat
cccccacttttcctccgctttcttaacctgctaatgaatgatgccatcttccttttggat
gaagccatacagtatttgagcaagataaagattcagcaaattgagaaggatcgaggtgaa
tgggatagtctgactccagaagcccgccgagaaaaggaggctggcctacagatgtttgga
cagctggcacgtttccataacatcatgtccaatgaaacaatcggtacccttgcctttctc
acatcagagatcaagtcactctttgtgcatcccttcctggctgagcgcatcatctccatg
ttgaactacttcctgcaacacctggttggccccaagatgggtgccttaaaagtcaaggac
ttcagcgaatttgacttcaaaccccagcagcttgtatcagatatctgcactatctactta
aatcttggggatgaggagaatttctgtgccactgtgcccaaggatggacgttcctattcc
ccaactctctttgcacagacagttcgagtcttgaagaaaataaataagcctgggaatatg
attatggctttcagcaacttggcagagagaatcaagtctcttgcagacctccaacaacag
gaagaggaaacctatgcagatgcctgtgatgagttcctggatcccattatgagcacactg
atgtgtgaccctgtggtgctgccatcttccagagtcactgtggatagatccaccattgca
agacatttgctcagtgaccaaacagatccctttaaccgtagtcccctcaccatggaccag
atccggccaaacacagaactaaaagaaaaaatccaacggtggcttgcagagaggaaacaa
caaaaggagcaacttgaatag

DBGET integrated database retrieval system