KEGG   Homo sapiens (human): 9356Help
Entry
9356              CDS       T01001                                 

Gene name
SLC22A6, HOAT1, OAT1, PAHT, ROAT1
Definition
(RefSeq) solute carrier family 22 member 6
  KO
K08203  
MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 6
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   9356 (SLC22A6)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    9356 (SLC22A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.3
AA seq 563 aa AA seqDB search
MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKN
GGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTI
VTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
FAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV
AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREE
GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS
IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE
LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQT
RQQQEHQKYMVPLQASAQEKNGL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcctttaatgacctcctgcagcaggtggggggtgtcggccgcttccagcagatccag
gtcaccctggtggtcctccccctgctcctgatggcttctcacaacaccctgcagaacttc
actgctgccatccctacccaccactgccgcccgcctgccgatgccaacctcagcaagaac
ggggggctggaggtctggctgccccgggacaggcaggggcagcctgagtcctgcctccgc
ttcacctccccgcagtggggactgccctttctcaatggcacagaagccaatggcacaggg
gccacagagccctgcaccgatggctggatctatgacaacagcaccttcccatctaccatc
gtgactgagtgggaccttgtgtgctctcacagggccctacgccagctggcccagtccttg
tacatggtgggggtgctgctcggagccatggtgttcggctaccttgcagacaggctaggc
cgccggaaggtactcatcttgaactacctgcagacagctgtgtcagggacctgcgcagcc
ttcgcacccaacttccccatctactgcgccttccggctcctctcgggcatggctctggct
ggcatctccctcaactgcatgacactgaatgtggagtggatgcccattcacacacgggcc
tgcgtgggcaccttgattggctatgtctacagcctgggccagttcctcctggctggtgtg
gcctacgctgtgccccactggcgccacctgcagctactggtctctgcgcctttttttgcc
ttcttcatctactcctggttcttcattgagtcggcccgctggcactcctcctccgggagg
ctggacctcaccctgagggccctgcagagagtcgcccggatcaatgggaagcgggaagaa
ggagccaaattgagtatggaggtactccgggccagtctgcagaaggagctgaccatgggc
aaaggccaggcatcggccatggagctgctgcgctgccccaccctccgccacctcttcctc
tgcctctccatgctgtggtttgccactagctttgcatactatgggctggtcatggacctg
cagggctttggagtcagcatctacctaatccaggtgatctttggtgctgtggacctgcct
gccaagcttgtgggcttccttgtcatcaactccctgggtcgccggcctgcccagatggct
gcactgctgctggcaggcatctgcatcctgctcaatggggtgataccccaggaccagtcc
attgtccgaacctctcttgctgtgctggggaagggttgtctggctgcctccttcaactgc
atcttcctgtatactggggaactgtatcccacaatgatccggcagacaggcatgggaatg
ggcagcaccatggcccgagtgggcagcatcgtgagcccactggtgagcatgactgccgag
ctctacccctccatgcctctcttcatctacggtgctgttcctgtggccgccagcgctgtc
actgtcctcctgccagagaccctgggccagccactgccagacacggtgcaggacctggag
agcaggtgggcccccactcagaaagaagcagggatatatcccaggaaagggaaacagacg
cgacagcaacaagagcaccagaagtatatggtcccactgcaggcctcagcacaagagaag
aatggactctga

DBGET integrated database retrieval system