KEGG   Homo sapiens (human): 93650Help
Entry
93650             CDS       T01001                                 

Gene name
ACPT
Definition
acid phosphatase, testicular (EC:3.1.3.2)
Orthology
K14410  
acid phosphatase [EC:3.1.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
Riboflavin metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    93650 (ACPT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     93650 (ACPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.4
AA seq 426 aa AA seqDB search
MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVAS
TLWPRGLGQLTTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANL
AGLFPEAAPGSPEARWRPIPVHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALE
GWTGFLSRLENFTGLSLVGEPLRRAWKVLDTLMCQQAHGLPLPAWASPDVLRTLAQISAL
DIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPLKMVMYSAHDSTLLALQGALG
LYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSLPGCPAPCPLG
RFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLR
ALGGPV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctggggttttggggccaccctgctggacctctcctgctgctgctgctgctg
gtgctgccaccccgggccctgccagaaggacccctggtgttcgtggctctggtattccgc
catggcgaccgggccccgctggcctcctaccccatggacccacacaaggaggtggcctcc
accctgtggccacgaggcctgggccagctgaccacggagggggtccgccagcagctggag
ctgggccgcttcctgaggagccgctacgaggccttcctgagtccggagtaccggcgggag
gaggtgtacatccgcagcacggactttgaccgcacgctggagagtgcccaggccaacctt
gccgggctgtttcccgaggctgctccagggagccccgaggcccgctggaggccgatcccg
gtgcacacggtgcccgtggctgaggataagctgctgaggttccccatgcgcagctgtccc
cgataccacgagctgctgcgggaggccaccgaggccgccgagtaccaggaggccctggag
ggctggacgggcttcctgagtcgcctggagaacttcacgggactgtcgctggttggagag
ccactgcgcagggcatggaaggttctggacaccctcatgtgccagcaagcccacggtctt
ccactaccagcctgggcctccccagatgtcctgcggactcttgcccagatctcggctttg
gatattggagcccacgtgggcccaccccgggcagcagagaaggcccagctgacagggggg
atcctgctgaatgctatccttgcaaacttctcccgggtccagcgcctggggctgcccctc
aagatggtcatgtactcagctcatgacagcaccctgctggccctccagggggccctgggc
ctctatgatggacacaccccgccatatgctgcctgcctcggctttgagttccggaagcac
ctggggaatcccgccaaagatggagggaatgtcaccgtctccctcttctaccgcaatgac
tccgcccacctgcccctgcctctcagcctccccgggtgcccggccccctgtccactaggc
cgcttctaccagctgactgccccggcccggcctcccgcccatggggtctcctgccatggc
ccctatgaggctgccatccccccagctccagtggtgcccctgctggccggagctgtagct
gtgctggtggcactcagcttggggctgggcctgctggcctggagaccagggtgcctgcgg
gccttggggggccccgtgtga

DBGET integrated database retrieval system