KEGG   Homo sapiens (human): 93650Help
Entry
93650             CDS       T01001                                 

Gene name
ACP4, ACPT, AI1J
Definition
(RefSeq) acid phosphatase 4
  KO
K19284  testicular acid phosphatase [EC:3.1.3.2]
Organism
hsa  Homo sapiens (human)
Disease
H00615  Amelogenesis imperfecta
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     93650 (ACP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 93650
NCBI-ProteinID: NP_149059
OMIM: 606362
HGNC: 14376
Ensembl: ENSG00000142513
Vega: OTTHUMG00000182961
Pharos: Q9BZG2(Tdark)
UniProt: Q9BZG2
Position
19q13.33
AA seq 426 aa AA seqDB search
MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVAS
TLWPRGLGQLTTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANL
AGLFPEAAPGSPEARWRPIPVHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALE
GWTGFLSRLENFTGLSLVGEPLRRAWKVLDTLMCQQAHGLPLPAWASPDVLRTLAQISAL
DIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPLKMVMYSAHDSTLLALQGALG
LYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSLPGCPAPCPLG
RFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLR
ALGGPV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctggggttttggggccaccctgctggacctctcctgctgctgctgctgctg
gtgctgccaccccgggccctgccagaaggacccctggtgttcgtggctctggtattccgc
catggcgaccgggccccgctggcctcctaccccatggacccacacaaggaggtggcctcc
accctgtggccacgaggcctgggccagctgaccacggagggggtccgccagcagctggag
ctgggccgcttcctgaggagccgctacgaggccttcctgagtccggagtaccggcgggag
gaggtgtacatccgcagcacggactttgaccgcacgctggagagtgcccaggccaacctt
gccgggctgtttcccgaggctgctccagggagccccgaggcccgctggaggccgatcccg
gtgcacacggtgcccgtggctgaggataagctgctgaggttccccatgcgcagctgtccc
cgataccacgagctgctgcgggaggccaccgaggccgccgagtaccaggaggccctggag
ggctggacgggcttcctgagtcgcctggagaacttcacgggactgtcgctggttggagag
ccactgcgcagggcatggaaggttctggacaccctcatgtgccagcaagcccacggtctt
ccactaccagcctgggcctccccagatgtcctgcggactcttgcccagatctcggctttg
gatattggagcccacgtgggcccaccccgggcagcagagaaggcccagctgacagggggg
atcctgctgaatgctatccttgcaaacttctcccgggtccagcgcctggggctgcccctc
aagatggtcatgtactcagctcatgacagcaccctgctggccctccagggggccctgggc
ctctatgatggacacaccccgccatatgctgcctgcctcggctttgagttccggaagcac
ctggggaatcccgccaaagatggagggaatgtcaccgtctccctcttctaccgcaatgac
tccgcccacctgcccctgcctctcagcctccccgggtgcccggccccctgtccactaggc
cgcttctaccagctgactgccccggcccggcctcccgcccatggggtctcctgccatggc
ccctatgaggctgccatccccccagctccagtggtgcccctgctggccggagctgtagct
gtgctggtggcactcagcttggggctgggcctgctggcctggagaccagggtgcctgcgg
gccttggggggccccgtgtga

DBGET integrated database retrieval system