KEGG   Homo sapiens (human): 9367Help
Entry
9367              CDS       T01001                                 

Gene name
RAB9A, RAB9
Definition
RAB9A, member RAS oncogene family
Orthology
K07899  
Ras-related protein Rab-9A
Organism
hsa  Homo sapiens (human)
Pathway
Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05162 Measles
    9367 (RAB9A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    9367 (RAB9A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.2
AA seq 201 aa AA seqDB search
MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQI
WDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV
ILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSD
HLIQTDTVNLHRKPKPSSSCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaatcatcactttttaaagtaattctccttggagatggtggagttgggaag
agttcacttatgaacagatatgtaactaataagtttgatacccagctcttccatacaata
ggtgtggaatttttaaataaagatttggaagtggatggacattttgttaccatgcagatt
tgggacacggcaggtcaggagcgattccgaagcctgaggacaccattttacagaggttct
gactgctgcctgcttacttttagtgtcgatgattcacaaagcttccagaacttaagtaac
tggaagaaagaattcatatattatgcagatgtgaaagagcctgagagctttccttttgtg
attctgggtaacaagattgacataagcgaacggcaggtgtctacagaagaagcccaagct
tggtgcagggacaacggcgactatccttattttgaaacaagtgcaaaagatgccacaaat
gtggcagcagcctttgaggaagcggttcgaagagttcttgctaccgaggataggtcagat
catttgattcagacagacacagtcaatcttcaccgaaagcccaagcctagctcatcttgc
tgttga

DBGET integrated database retrieval system